SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909691|ref|YP_323987.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909691|ref|YP_323987.1|
Domain Number 1 Region: 255-633
Classification Level Classification E-value
Superfamily SIS domain 3.43e-99
Family double-SIS domain 0.000000252
Further Details:      
 
Domain Number 2 Region: 2-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.2e-70
Family Class II glutamine amidotransferases 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909691|ref|YP_323987.1|
Sequence length 633
Comment glucosamine--fructose-6-phosphate aminotransferase [Anabaena variabilis ATCC 29413]
Sequence
MCGIVGYIGTQAATEILLAGLEKLEYRGYDSAGIATVWEGDVNCVRAKGKLHNLRSKLEQ
LATPSQIGIGHTRWATHGKPEEYNAHPHLDTAMRIAVVQNGIIENYRELRDELKQKGHEF
RSETDTEVIPHLIAEFLKNLPSPALPTSSSSLLEAIRQAVNHLQGAFAIAVISADYPDEL
IVVRQQAPLVIGFGQGEFFCASDTPAIVSHTRAVLPLENGEIARLTPLGVEIYNFAGDRL
KKQPRLLNLNPTMVEKQGFKHFMLKEIYEQPGVVRASLEAYFNPDTNTDESFTSPVNLGL
SEEIYADLEQIHIVACGTSWHAALVGKYLLEQLAGISTQVHYASEYRYAPSPLTANTLII
GVTQSGETADTLAALAMEKERRQGKEAKYQARLLGITNRPESSLGHLVPHIINTLAGIEI
GVAATKTFVAQLMAFYALALDLAYHRQTVAPDKLADIIQGLRQIPKEIEATLERQEKLTE
HLAHEFAETQDFIFLGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDAKVP
VVAIAYPGSVYEKVISNSQEAKARDSRLIGVTPVNDGEAAEIFNDLLPVSSVDELLSPIL
TVVPLQLLAYHIAARRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences A0A1W5CE61 Q3M7E4
240292.Ava_3485 gi|75909691|ref|YP_323987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]