SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909736|ref|YP_324032.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909736|ref|YP_324032.1|
Domain Number 1 Region: 346-542
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.37e-52
Family Ppx associated domain 0.0019
Further Details:      
 
Domain Number 2 Region: 150-332
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.15e-43
Family Ppx/GppA phosphatase 0.0012
Further Details:      
 
Domain Number 3 Region: 23-146
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.08e-35
Family Ppx/GppA phosphatase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909736|ref|YP_324032.1|
Sequence length 550
Comment Ppx/GppA phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MVNLVSSSWESVNTQPVQQHRIIAAIDMGTNSLHMVVVKIDPTLPAFSIVSREKETVRLG
DRNITTGELKPQVMAKAIATLKRFQEAAKTANAEALIAVATSAVREAPNGKDFLHQIETE
LGLSVDLISGQEEARRIYLGVLSGMEFHNQPHLIIDIGGGSTELILGDTQEPRTLTSTKV
GAVRLTSELITTDPISNIEFQYLQAYARGMLERSVEEVLANLNPGESPRLIGTSGTIETI
AMIHAREKTGTVPSTLNGYQFTLKDLREWVNRLRRMTNAERAAIPGMPEKRSEVILAGAV
ILQEAMTLLGVESLTACGRALREGVIVDWMLSHGLIEDRLRFQSSIRQRSVLKQASKYQV
NLEYSDRVATFALSLFDQTQGLLHHWGSNERRLLWAAAILHNCGHHVSHSSHHKHSYYLI
RNSELLGYNETEIEIIANLARYHRKSPPKKKHENYRNLLSKEHRQIVSQLSALLRLAVAL
DRRQIGAIAQIKCDYYHHFQQFNLLIYPSRPDDDCALELWSLDYKKAVFEAEFGVKLLTH
LEKNLLPNFS
Download sequence
Identical sequences A0A1W5CBF1 Q3M799
gi|75909736|ref|YP_324032.1| 240292.Ava_3530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]