SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909834|ref|YP_324130.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909834|ref|YP_324130.1|
Domain Number 1 Region: 341-586
Classification Level Classification E-value
Superfamily beta-Roll 7.01e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily beta-Roll 5.36e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Domain Number 3 Region: 54-268
Classification Level Classification E-value
Superfamily beta-Roll 9.59e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909834|ref|YP_324130.1|
Sequence length 589
Comment hemolysin-type calcium-binding protein [Anabaena variabilis ATCC 29413]
Sequence
MTIICGTNSNDYLYGGDESDTIKGFAGYDYLYGGLGDDYLYGGLDNDKLYGGLGNDKLYG
GEGNDNLNGEEGNNSLYGEAGDDTLDAGNSTGNNLLDGGEGNDEIYVYSSSGDNTLKGGA
GNDILDVRFSYGKNILDGGSGNDQLYARYSQGNNSLRGGSGDDYLGVDLSAGNNILDGGD
GNDILDISYQWKGKNIVSGGNGNDIFYAYGVQGSNTLNGGSGNDSFYISSPDANTVVHPL
ATQTVDGGTGYDYLCIDYSSAIAGITSSFNTTTKQGLITADTNQIRYKNIEQLKIIGTAY
DDIIVGGNSDDIIDGGSGGNDTLNGGAGNDILSIRGNSRNNNTVYGGAGNDSLYANDTAG
TNLLDGGDGNDYLSATNNYSYFFNASQTLIGGAGDDTLDVSGSYGNNFLYGGAGNDSLYA
DYSVGPHTLDGGDGDDYLSAKGSSSRFIINTHILDGGAGNDILDVGSARAKNKLIGGGGN
DILIGGLNEDTFVFKNYNEGIDRIYNFDHLDRIQICAVGFGGGLSPDSLSAGQFTLGTVA
TTNDQRFIYDTSNGALYFDQDGNGSGFHQVQIAQLYGVPSLSVSNFVVV
Download sequence
Identical sequences A0A1W5CNI6 Q3M701
gi|75909834|ref|YP_324130.1| 240292.Ava_3629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]