SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909848|ref|YP_324144.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909848|ref|YP_324144.1|
Domain Number 1 Region: 799-905
Classification Level Classification E-value
Superfamily CalX-like 3.4e-30
Family CalX-beta domain 0.00062
Further Details:      
 
Domain Number 2 Region: 969-1151
Classification Level Classification E-value
Superfamily beta-Roll 5.32e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 2-133
Classification Level Classification E-value
Superfamily beta-Roll 1.44e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00064
Further Details:      
 
Domain Number 4 Region: 128-273
Classification Level Classification E-value
Superfamily beta-Roll 1.57e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00082
Further Details:      
 
Domain Number 5 Region: 406-551
Classification Level Classification E-value
Superfamily beta-Roll 6.28e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00088
Further Details:      
 
Domain Number 6 Region: 267-412
Classification Level Classification E-value
Superfamily beta-Roll 9.81e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00082
Further Details:      
 
Domain Number 7 Region: 556-675
Classification Level Classification E-value
Superfamily beta-Roll 4.45e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 8 Region: 669-788
Classification Level Classification E-value
Superfamily CalX-like 1.96e-19
Family CalX-beta domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909848|ref|YP_324144.1|
Sequence length 1180
Comment Na-Ca exchanger/integrin-beta4 [Anabaena variabilis ATCC 29413]
Sequence
MDPISGTNGNDNLSGTSGDDIIQGFNGNDTLSGLGGNDRLEGGRGDDTLTGGAGNDVFNF
EQLQDNDVVTDFVRGQDKIDVRNLNINDWATLQLLISNDGQDNALITTFSSGSQSRIKLL
NINPNLLQASDFIFNTVNLNQTIEGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFE
GGRGDDTFYGGAGNDVFNLEQLQDNDVVIDFVRGQDKIDVRNLNINDWATLQLLISNDGQ
DNALITTFSSGSQSQIKLLNINPNLLQASDFIFNTVNLNQTIDGTNFADQLFGGLGNDTL
RGFNGNDVLFGEQGDDRFEGGRGDDTFYGGAGNDVFNLEQLQDNDVVIDFVRGQDKIDVR
NLNINDWTTLQLLISNDGQDNALITTFFNGSQSRIKLLNINPNLLQASDFIFNTVNLNQT
IEGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFEGGRGDDTFYSGAGNDVFNLEQL
QDNDVVIDFVRGQDKIDLRSLNISDWSTLQTLISNDGQNNALITTFFNGSQSQIKLNNIN
PNLLQASDFIFNTNTVNNNETIDGTNFADQLFGGLGNDTLRGFNGNDVLFGEQGDDRFEG
GAGNDTFYGGAGNDIAVYSGTRSQYQVTSSGGVFTVTDTVANRDGVDTLREVEQIQFSDQ
TITIGNTSPTITLAVSPASVTEDGTPNLIYTFTRTGSTTNALTVNYSVAGTATLNTDYAQ
SGATSFTATTGTITFAAGASTAILTINPTADTTVESNETVALTLATGTGYTVGTTTAVTG
TITNDDTSPTGITINLSGSQTIVEGSTSPQNVTYTVTLSQASSQIITVQYATANGTATAG
SDYTSTTGTLTFNPGETSKVINIPILNDSVNEANETFTLRLTSPTNATLGTTNTVTTTIT
DTLSASVTTTLPTNVENLTLTGTAAINGTGNAGNNVLTGNSGNNILSGGAGNDTYAFVAN
AALGTDTITETATGGIDTIDFSGSTGAVRVNLGVTTSQTVNSNLKLILSANNVIENATGG
TGNDRLTGNALNNILAGGNGNDQLQGLAGNDTLWGGLGDDILTGGAGQDKYLFQSSGVFS
SSLGVDYISQFDVGQDQIVLSKATFNAVTNSAGQALTDFAVVSDDEFVNASSARIVYSQG
SGSLFYNRDGNVLGTGTVFEFARLGNPDITLSSSDFSLIA
Download sequence
Identical sequences Q3M6Y7
gi|75909848|ref|YP_324144.1| 240292.Ava_3643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]