SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909850|ref|YP_324146.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909850|ref|YP_324146.1|
Domain Number 1 Region: 7-328
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.01e-117
Family TK-like PP module 0.00000000137
Further Details:      
 
Domain Number 2 Region: 343-533
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-65
Family TK-like Pyr module 0.000000564
Further Details:      
 
Domain Number 3 Region: 538-670
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.27e-42
Family Transketolase C-terminal domain-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909850|ref|YP_324146.1|
Sequence length 670
Comment transketolase [Anabaena variabilis ATCC 29413]
Sequence
MAVATQSLEELSINAIRFLAVDAIEKAKSGHPGLPMGAAPMAFVLWNRFMRYNPKNPKWF
NRDRFVLSAGHGSMLQYALLYLTGYDSVSIEDIKQFRQWESKTPGHPENFMTAGVEVTTG
PLGQGIANGVGLALAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEAASLAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSQRFESYGWHVIHVKDGNTDLEAIHKAIEEAKA
VTDKPTLIKVTTIIGYGSPNKSNTAGVHGAALGGDEVALTRQNLGWSHDPFVVPEDVLNY
TRKAVERGAGYESDWNKTYADYKAKYPQEAAEFERHLSGKLADGWDKVLPSYTPEDKGLP
TRKHSETCLNKLAAVLPELIGGSADLTHSNLTEIKGKGDFQKGQYQNPNIHFGVREHGMG
AICNGIALHGSGLIPYGATFLIFSDYMRAPIRLSALSQAGAIWVMTHDSIGQGEDGPTHQ
PIETLASLRAIPNLTVIRPADGNETSGAYKVAIERAKNNAPTLLAFTRQNVPNLAGTSID
NVAKGGYIVVDTDGTPDLILIGTGSELSLCVTAAEKLKAEGKKVRVVSLAAWDLFDAQDA
AYKESVLPKAVTKRLAVEAASSFGWHKYIGSEGDVVTIDRFGASAPGGICLEKFGFTVDN
VLAKAKQLLG
Download sequence
Identical sequences A0A1W5CP96 Q3M6Y5
gi|75909850|ref|YP_324146.1| 240292.Ava_3645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]