SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909926|ref|YP_324222.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909926|ref|YP_324222.1|
Domain Number 1 Region: 21-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.96e-28
Family Anti-sigma factor antagonist SpoIIaa 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909926|ref|YP_324222.1|
Sequence length 129
Comment anti-sigma-factor antagonist domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MLLYNIGKFSTSFYSKLVKNTMNQQVQVIKLSGIINTANSQELREEITHLLNSGTKIVLV
DCQDVIFMDSSALGALVLAFKTLRAAGTKLFLCSINEQVRILFELTGMDKVFEIFNNQDE
FNQIILANS
Download sequence
Identical sequences Q3M6Q9
240292.Ava_3722 gi|75909926|ref|YP_324222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]