SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909942|ref|YP_324238.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909942|ref|YP_324238.1|
Domain Number 1 Region: 99-155
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000981
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909942|ref|YP_324238.1|
Sequence length 190
Comment hypothetical protein Ava_3738 [Anabaena variabilis ATCC 29413]
Sequence
MLNRSSLTQKLVIFTALLSIGLVFHQQVKEPQRLFQLNSHLWVSEKKVNIANLADGSYQF
CSQPDPQDWRDGAGVCANFHKTAHHFNGYYGYPHSDNFICIRGNIKGNLIVGEALSILWA
DEQQNNISTSAFKWDSEERLTLSQGNLISTANHADAVQWIIYRQALLNLEGFYQYNRPRM
TPVSQLCHWK
Download sequence
Identical sequences A0A1W5CLW7 Q3M6P3
240292.Ava_3738 gi|75909942|ref|YP_324238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]