SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909988|ref|YP_324284.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909988|ref|YP_324284.1|
Domain Number 1 Region: 3-603
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.57e-160
Family Prokaryotic type I DNA topoisomerase 0.0000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909988|ref|YP_324284.1|
Sequence length 728
Comment DNA topoisomerase I [Anabaena variabilis ATCC 29413]
Sequence
MPKRLLVVESPGKVKKLSQILGSEWIVRASCGHIRELSDEGEDALGFSMDGGSVQCHYVP
RDQRSKETIQQLKSAAKQVSEVVLATDPDREGETIAWHLKEVLGLREPKRVVYTEITASA
VQSAIAHPRKLDLNLVGAGLCRDCLDKLVGYKGSPLVWALNNGAKSVGRVQSSTLHLICQ
REREIQSFVPQDYWSVWVDYVEGFRAFYKGAVNTRSDSPETEVEIHDDAAGNSTTAPEST
RVLAEAEANRLVEEARRHPHQIVQYEGKIANRQPPPPFITSTLQQAAGSKLKFAPEKTMQ
LAQKLYEAGLITYMRTDSVMLSPEFCESARQWLEQNDPQNVPKQVARHRSSKTAQQGHEA
IRPTDVFRPSAQLRIELSTDEFNLYVMIWKRAIASQCRPAQLRKTVVITQSGQILWQARG
QVVEFLGYTRYWPNLSKDTLLPTLQQGQMVTLENAGHEKKQTQPPPRYSEPKLVQLMERK
GIGRPSTYSPTIATLKKRGYVELTKDNLHPTNLGLEVDTFLQKALPDLLEAEFTAKMENA
LDAIAEGKQPWQIYLTTWNQNYFAPALAKAKTIAVDSGNPTKTFPPRQYDTSRTRCPDCN
NFLSKIPSSKLKKKYFLKCTSGCENTVLFWSEFSKTWQAPRTKDDKMAENGQKNHLSPAT
KLPTQLTAYPCPVCKRPLEEYTYTKDGQKKTMLRCSASSSRTDKKHQDVAYFHTAKGWWS
PKFGEINK
Download sequence
Identical sequences A0A1W5CLR0 Q3M6J7
gi|75909988|ref|YP_324284.1| 240292.Ava_3784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]