SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910118|ref|YP_324414.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910118|ref|YP_324414.1|
Domain Number 1 Region: 3-375
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.71e-116
Family Cystathionine synthase-like 0.0000000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910118|ref|YP_324414.1|
Sequence length 400
Comment aromatic amino acid beta-eliminating lyase/threonine aldolase [Anabaena variabilis ATCC 29413]
Sequence
MSVIYLDNNATTKVDPEVVEAIMPYLTDYYGNPSSMHTFGGQLGKAVRTAREQVAALLGA
DESEIVFTSCGTEGDNAAIRAALLAQPEKRHIITTQVEHPAVLNVCKQLETQGYTVTYLS
VNGHGQLDLDELEASLTGNTALVTIMYANNETGTVFPIEEIGKRVKERGAIFHVDAVQAV
GKIPLNMKTSTIDMLTISGHKIHAPKGIGALYVRRGVRFRPLLIGGHQERGRRAGTENVP
GIVGLGKAAELELIHIETAIKKETRLRDRLEQTLLAKIPDCEVNGDVTQRLPNTTNIGFK
YIEGEAILLSLNKYGICASSGSACTSGSLEPSHVLRAMGLPYTTLHGSIRFSLCRYTTEA
QIDRVIEVMPEIVERLRALSPFKNDEAGWLQAQEQTLAHR
Download sequence
Identical sequences A0A1W5CM57 Q43884 Q44507
gi|75910118|ref|YP_324414.1| 240292.Ava_3914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]