SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910166|ref|YP_324462.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910166|ref|YP_324462.1|
Domain Number 1 Region: 421-525
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 5.23e-24
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 357-419
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000206
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0026
Further Details:      
 
Domain Number 3 Region: 304-355
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0000248
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.01
Further Details:      
 
Weak hits

Sequence:  gi|75910166|ref|YP_324462.1|
Domain Number - Region: 165-353
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0107
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910166|ref|YP_324462.1|
Sequence length 538
Comment mechanosensitive ion channel MscS [Anabaena variabilis ATCC 29413]
Sequence
MLFHILAIAGSMAITVVSMPKATAQIPFLPQLQLPSSISNESDSRVVSDWVYLDGRRLFQ
IAATKTNLAERRENIEQNLQEITQNYVRSSATEADIQVRTLNGLPVIYVNNRYLMTITSQ
DASLGEGDAFTLAESIKESLKQDLQRARRERQTQFIIDQAKIAGAIALAMMIASWGTTHW
QRRALRHGVKSNVSSPPVAKQITTQLNQQQHQHLQEVKRRLFQFTQVGIWGSGNLIILGL
FPYTRTFQVAIFTAAQIPLRLAVVGVGTYVAIRLTYALIDRFTTTLISSGALLTPEASER
MQLRVSTFSGVTKSIATIVCIGVGILLALVALGIDIVPLLAGASLVGVAVSLASQNLIKD
AINGFLIILEDQYALGDVINVGNVGGLVENLNLRMTQVRDSEGRLITIPNSEIKIVANLS
SRWSRADLTIPVDYQADIDQALKLIRDVALKMDQDPLWQRQIIETPQVLGIDNFGDRGLI
IRVWIKTQPLKQWDVAREYRRRLKIAFDKAGIFIPVPQQAIWVNENQLPPPQENGKAS
Download sequence
Identical sequences Q3M619
gi|75910166|ref|YP_324462.1| 240292.Ava_3962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]