SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910203|ref|YP_324499.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910203|ref|YP_324499.1|
Domain Number 1 Region: 804-1167
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 2.75e-72
Family Thermostable phytase (3-phytase) 0.000000189
Further Details:      
 
Domain Number 2 Region: 1656-1839
Classification Level Classification E-value
Superfamily beta-Roll 2.09e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 29-101,157-182,210-314,345-407
Classification Level Classification E-value
Superfamily DNase I-like 3.36e-21
Family DNase I-like 0.079
Further Details:      
 
Domain Number 4 Region: 448-561,591-648,813-862
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000863
Family Methylamine dehydrogenase, H-chain 0.075
Further Details:      
 
Weak hits

Sequence:  gi|75910203|ref|YP_324499.1|
Domain Number - Region: 1304-1460
Classification Level Classification E-value
Superfamily YWTD domain 0.00183
Family YWTD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910203|ref|YP_324499.1|
Sequence length 1844
Comment phytase [Anabaena variabilis ATCC 29413]
Sequence
MFIIQSFIGVATPQTLDVIENKFMVNTTVRFSQFNASLNRNAEGQLVSDLSTPNNAQAKA
VAEIIQRNNPDVLLINEFDYDSDDPLEAVRLFQQNYLGVSQNGATPVNYPYVYIAPSNTG
IASGFDLNNNGVAVTTPGASGYGDDAFGFGSFPGQFGMLLLSKYPIDTANVRTFQNFLWK
DMPDSLLPTIQSPGSQTPWYSPEEQAVLRLSSKSHWDVPILVNGETVHVLVSHPTPPVFD
GAEDRNGKRNHDEIRFWADYITPGEGGYIYDDAGGTGGLAAGSSFVIMGDQNADPYDGDS
FDNAILQLLQNPGVNTNFIPSSPGAAQQSALQGGANTNHQGNPSFDTADFADTTPGNLRS
DYVLPSTDLQITNSQVFWPVNNDPTFPPVGTFPFPSSDHRLVSVDVQVGATEAGKTITEL
EFQGQTTFPTGFIPNGAAGVVNGLAAPVGGLSGVTYDAANNRYYAISDDRSQFAPARFYT
FTNNGDVTFTDVVTLKDRNGNTFALSSLDPEGIALTNNGTVFISSEGEANPSAGRVTNPF
IREFSLTTGQEVRSLFVPTKFLPVVQDTNNNGVVDTGDTQTSGVRNNLAFESLTITPDQK
TLFTATENALFQDGARASLTGGSRSRILQYNLVSGQPEKEYLYITDAIAASPNPATGFSD
NGLVDLLAIDNRGTLLAVERSFAQGVGNTIKIYEISLQGATDISTINSLDSLNTTEFAAI
QPAQKRLLLNLNDLNLPNGTDNIEGISFGPKLADGSQSIVLVSDNNFSGTQFTQILTLSA
EIVPTVTPTVETRPDLLDDDNPSIPVIDQNADADDPAIYVNATNPDASLVITSVKNAGLR
VYDLSGNLLQSINPGGIRYNNVDLQYGFQLGGQSIDIAVASDRQNDKLVFFKINPNPSTP
GQYLENITDSNLGTLFQGAPFAPPYSSSSRSAYGLALYRSPFTNDYYVFVNRRQTGDIAQ
LKLIDQGNGKIGTQLVRQFTIPTDAGIDPQTEGMVVDQETGFLYIGQENVGIWKYEAEPN
RGNTGRLIDRIKDLGGSYLTDDVEGLTIYYGENGTGYLLASSQGENTFVAYTREGNNDYI
GSFAVGNNGAIDSVQESDGADVVNVPLGANFPFGLFVTQDGDNQPANVVDGENVNANFKL
VPWENIANAFSQPLDIDTTSYDPRNPVAQPRLTIYDFDNLPKLGTTSAGQDIFLGGFSGL
YFQGIAANGNLKFVTHTDRGPNGENIGANRPFALPNFQPEIISFELNRATGEITITQRTG
LFRQDGTTPLTGLPNLQAGARNTAYTDEIPVNLQNQILPNDPLGADLEGIVVDKNGDYWL
VDEYRPAIYHFDSNGKLIERFIPRGTATAPNPDQPAGTFGIEVLPEVYAQRRNNRGFEAV
ALEGNKLYAFIQSPIDNPDNTGDTVSRSSRNLRILEFDLVSKQVTAEYIYLLEGLPNTDK
IGDAVSLGKGKFAVVERDDGETADANKLIFLIDLAGATNINNPANYSLPSGKTIEQLTPD
ELTAANVTPVSKSLIANAAELGYTGVGKLEGLALVAPNTLALLNDNDFGVTGTTTNPDGT
ISIRVAPLPERLALLELPNNLPVTQPLDIQFGSSGSDNITAEPGQILFTGDGADTVDSPG
NNTISTGNGDDTVFVGSNASVSTGNGNDQVFIGVNGPASNTTANGGNGEDEITVIEAGGS
NNLFGAAGNDTLQVIEGSRQFAFGGSGNDTLTSNGSYNRLNGGSGDDKLFSSVNDSLFGG
DGDDVLFAGQAGSNRLSGGAGADQFWIANGSLPTSKNTVTDFAVGVDKIGLGGIGVTQFS
ALSLVQQGADTLVKLGATELVILQGINSTSLTLTDFVFAVSVVA
Download sequence
Identical sequences Q3M5Y2
240292.Ava_3999 gi|75910203|ref|YP_324499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]