SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910275|ref|YP_324571.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910275|ref|YP_324571.1|
Domain Number 1 Region: 13-75
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000322
Family 7-Fe ferredoxin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910275|ref|YP_324571.1|
Sequence length 80
Comment 4Fe-4S ferredoxin [Anabaena variabilis ATCC 29413]
Sequence
MEHDVMALINQRVDVPVIVDESKCLEKCTACIEVCPLDVLAKNPETGKAYMKYDECWFCL
PCEKECPANAITVQIPFLLR
Download sequence
Identical sequences Q3M5R0
240292.Ava_4072 gi|75910275|ref|YP_324571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]