SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910308|ref|YP_324604.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910308|ref|YP_324604.1|
Domain Number 1 Region: 1129-1699
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-166
Family Acetyl-CoA synthetase-like 0.00000000745
Further Details:      
 
Domain Number 2 Region: 257-664
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.5e-92
Family GABA-aminotransferase-like 0.00000476
Further Details:      
 
Domain Number 3 Region: 893-1158
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.34e-59
Family CAT-like 0.038
Further Details:      
 
Domain Number 4 Region: 714-887
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.33e-44
Family NRPS condensation domain (amide synthase) 0.0045
Further Details:      
 
Domain Number 5 Region: 1679-1751
Classification Level Classification E-value
Superfamily ACP-like 3.27e-20
Family Peptidyl carrier domain 0.0025
Further Details:      
 
Domain Number 6 Region: 24-104
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000327
Family Acyl-carrier protein (ACP) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910308|ref|YP_324604.1|
Sequence length 1786
Comment amino acid adenylation protein [Anabaena variabilis ATCC 29413]
Sequence
MNTYTIDNHNSYSLVTNQSQECQNTLANLRVIIADLLKCEPEEVDVKVPFLEMGADSIVL
VDAIRQIENNFRIKITIRQLFEELTNLSVLANYIEENVKLEPSTLLGQETLELSVNPQPL
PQSQQSEQKSETLVEIVLRQQFELMSQQLEILRESNLPTNLSVTPSQNQAAKSVPNAVVQ
TTPDLKTGELNKSTLKKADSPSSFWRVEQSQAKTLTSQQQQYLNSLIARYTKRTAKSKQR
SQSYRPVLADRRASIGFRPETKEILYPIVGDRSQGSRIWDVDGNEYIDISMGFGVHLFGH
NVPFITAALEDQIKQGIQIGPQSKLAGEVATLICEMTGMERVTFCNSGTEAAMTAMRIAR
AATGRAKIAIFKGAYHGHFDGTLAIPQTSEDGKLPAQPMVPGVLQNMVDDVLLLTYGTPE
SLEIIKANAHELAAVLVEPIQSRKPDLQPKEFLQQLRVVTQQLDIALIFDEVITGFRVHP
RGAQAWSGVDADIVTYGKLIGGGMPIGVIAGKAAYMDKIDGGFWSYGDDSYPEVETTFFA
GTFSKHPLTMAATRATLLHLKAEGASLQERLNQRTSNLAATLNSYFEQANVPLRIVHFSS
LFRFTLSGNSSYLYQPLEMDLLYYSLIEKGVYIWEGRTCFLSTAHTDEDVDYVIQAVKDS
VQELQAVGFFSKSPKLSTNQPQTPKTSERVNSAVSLTVQDTIKPEVKEAFKIPLSDAQKQ
LWFLAQMGDNGSVAYNISLNIQLQGTLDLAAIRQAVQQVVQRHEALRTTISSQGDFQEIL
PSLKIDVPVIDFSNVKDSQLQVNQWLQNYSRESFDLSNGPLFRVRILKLAEQLHLLVVSA
HHIITDGWSISIILQEMMALYSAKCQGHVCQLEPPIQFSSYLDWHRQFCATDEMKAHESY
WLQKFADPVPVLDLPTDRQRPPSKTYQGGRQQLLLDPNVSAAIKQLSKQNGCTLFMTLLS
AYAVLLYRLTNQDDLTIGIASAGRSLEGSERLVGYCSHMLPIRTQIVGDATFVEHLKACK
SVLLEAYEHQDYPFAKLIDKLRVNSNTGMSPLVNATFNLERPVAIPQMYGLESSLLPQSI
SFADYDIGLNVTEIDHELLLECDYNADLFDAATIDRILGHYQTLLLGIIASPQTLVSQLS
LLTATERQQILVEWNQTQIDYDRNQCVHQIFEQQAQLTPNAVAVESGEQKLTYRELNHRA
NQLAHFLQSLGVKPEVLVGICVERSVEMLVAMLGVLKAGGAYLPLDPAYPQERLAHMLTD
SQASVLLTSANLASQLPKSSAKLVKLDTDWQVISRQPIINPTGIVVPSNLAYVIYTSGST
GKSKGVLIPHQALVNHNYAIAKNYELKASDRILQFASFSFDVAAEEIFPTWLSGATLVLR
PEEIFSIPDFVQFVKQQDLTVLNLPVAYWQEWVSQMPQISWTPNVRLLVVGSERVPLERF
LTWQQLVGSNVSWRNAYGPTEATITATIYGSHLSSHQQTAASLFIGRPIANTQIYILDQH
LQPVPIGVTGELHIGGNGLAQGYLHRPELTAEKFIAHPFSNQPTARLYKTGDLARYRSDG
TIEFIGRIDHQVKIRGFRIELGEIETALNQHPQVRECVVIASDDQLAHQQLQAYIVFHQQ
LKVDSSELHRFLKQKLPEYMIPTSFFQLENIPLTPNAKIDRQALNRLGVLINNIEVNRVA
PSNHIEEVLANIWTEVLNLKQVGIHNNFFELGGNSLLAMQLLNRVNEAFLIDLPLRSLFE
CSTIAELSELIQAYKLEHLESDALEQILAEVDELIDTEIEQMLAKF
Download sequence
Identical sequences A0A1W5CDR2 Q3M5M7
240292.Ava_4109 gi|75910308|ref|YP_324604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]