SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910329|ref|YP_324625.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910329|ref|YP_324625.1|
Domain Number 1 Region: 27-157,213-385
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 483-583
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000308
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Domain Number 3 Region: 401-475
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000166
Family P22 tailspike protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910329|ref|YP_324625.1|
Sequence length 848
Comment filamentous hemagglutinin-like protein [Anabaena variabilis ATCC 29413]
Sequence
MFNLQTTKILFFFTLCLVLETPLKGLAQTQLNPDHTLPTNVNSIGGVYDITGGNRPNNGA
NLFHSFQDFSIQSGDTARFIYDTGISNIITRITGGSPSQINGTIQTLLNGTNNIGNANLF
LINPHGIIFGANAKLDIGGSFIGTTADSIKFNDGKEFSAINPTVNPILTVNVPIGLQFGS
HPTSTIQVQGSGNNFQLNPDLSVDNSNRPSGLSYQTPNAQTLALVAGKVELAGGNITVPQ
GRIELWSVNRGEVTITNPSGHLQLQPTPGISYGNVDLVNAASVDASGNSGGSIEVRGQNV
TLDNGSVIVTDTTGSGSGGILNISASEVLTVKGFVLNPNNQISSGISADVASGASGEGGK
VTVTTKTLQVSNGGQISSGTFGTGNAGELNVTAQDVQIRGISLFGPSGLFAPVAPGARGN
GGNLTVETNKLQVTDGGQIFTNTLGFGKAGDLKILAQDVEVSGGTEFGPSTIAATVQKIL
SIPEPAATFLGAGFGNAGNLIIETSNLRVTDGGQIAVSTSGNGSAGNMTINANSVELAGT
NQFGRSGLFANAIVGKGQGGDVNISSDRLVVRDGATINVSSFLSRDPGNLRGLAGKGAAG
NINLNSADILLANQGIITADTNAGDKGNITIQSDTLQILRGSQISTNARNSAVGGNINIT
TNTLVAYENSDISANAQKGFGGRVVVNAKAVFGIQFRPQPTPDSDLTASSDLGAEFNGTV
ELNTLDVDPTSGLVKLPTNFSDRSQQIASGCSVTQKNRFVVSNRGGLPTNPTDTLRGEIV
WYDVRDLSNEVANSTAGSNYQTVNNQEPIVEAQGLIVGADGTMQLLASIPQVTPLTPWQV
SPSCDVKP
Download sequence
Identical sequences A0A1W5CDC8 Q3M5K6
240292.Ava_4131 gi|75910329|ref|YP_324625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]