SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910353|ref|YP_324649.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910353|ref|YP_324649.1|
Domain Number 1 Region: 4-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.78e-129
Family Cystathionine synthase-like 0.0000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910353|ref|YP_324649.1|
Sequence length 378
Comment cystathionine gamma-lyase [Anabaena variabilis ATCC 29413]
Sequence
MEFETKAIHEGQQSDPQTGAVIVPIYLTSTYQQEAIGQHKGYEYSRTGNPTRNALEEALA
AIENGEYGLAFASGLAATTTVLSLLKSCDHIVAGDDLYGGTYRLLERVVKNWGVTTTYVD
IDDISNFAKAIQPNTKLIWVETPTNPLLKIIDIAALANIAEQNNLILVVDNTFASPYFQR
PLDNGADIVVHSTTKYLGGHSDIIGGAVVTSNEQLYTELKFYQNAIGAVPSPFDSWLVLR
GIKTLAVRMREHEKNALLLAQFLEQHPKVERVYYPGLPSHEQHQLAKSQMSGFGGMISLE
LKGDFADVEKFASRLQLFLLAESLGGVESLLCYPAKMTHGSLPQEERYKRGINDNLVRLS
VGIENVLDLQADLENALS
Download sequence
Identical sequences A0A1W5CD88 Q3M5I2
240292.Ava_4155 gi|75910353|ref|YP_324649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]