SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910358|ref|YP_324654.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910358|ref|YP_324654.1|
Domain Number 1 Region: 1896-2084
Classification Level Classification E-value
Superfamily beta-Roll 8.11e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00054
Further Details:      
 
Domain Number 2 Region: 5888-6043
Classification Level Classification E-value
Superfamily beta-Roll 3.31e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 5060-5301
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000583
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 4 Region: 1494-1601,1631-1737
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000014
Family Serralysin-like metalloprotease, C-terminal domain 0.0041
Further Details:      
 
Domain Number 5 Region: 840-1006
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000544
Family Serralysin-like metalloprotease, C-terminal domain 0.004
Further Details:      
 
Domain Number 6 Region: 972-1134
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000118
Family Serralysin-like metalloprotease, C-terminal domain 0.003
Further Details:      
 
Domain Number 7 Region: 182-409
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000501
Family Serralysin-like metalloprotease, C-terminal domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1098-1262
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000131
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 
Domain Number 9 Region: 437-651
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000327
Family Serralysin-like metalloprotease, C-terminal domain 0.0043
Further Details:      
 
Domain Number 10 Region: 1227-1412,1442-1456
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000288
Family Serralysin-like metalloprotease, C-terminal domain 0.0023
Further Details:      
 
Domain Number 11 Region: 5657-5762
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000654
Family Serralysin-like metalloprotease, C-terminal domain 0.009
Further Details:      
 
Domain Number 12 Region: 6051-6203
Classification Level Classification E-value
Superfamily beta-Roll 0.000000186
Family Serralysin-like metalloprotease, C-terminal domain 0.0054
Further Details:      
 
Domain Number 13 Region: 5771-5877
Classification Level Classification E-value
Superfamily beta-Roll 0.000000419
Family Serralysin-like metalloprotease, C-terminal domain 0.012
Further Details:      
 
Domain Number 14 Region: 5542-5647
Classification Level Classification E-value
Superfamily beta-Roll 0.000000445
Family Serralysin-like metalloprotease, C-terminal domain 0.015
Further Details:      
 
Domain Number 15 Region: 5426-5532
Classification Level Classification E-value
Superfamily beta-Roll 0.000000471
Family Serralysin-like metalloprotease, C-terminal domain 0.017
Further Details:      
 
Domain Number 16 Region: 6281-6386
Classification Level Classification E-value
Superfamily beta-Roll 0.000000523
Family Serralysin-like metalloprotease, C-terminal domain 0.019
Further Details:      
 
Domain Number 17 Region: 1771-1925
Classification Level Classification E-value
Superfamily beta-Roll 0.000000693
Family Serralysin-like metalloprotease, C-terminal domain 0.0044
Further Details:      
 
Domain Number 18 Region: 5313-5417
Classification Level Classification E-value
Superfamily beta-Roll 0.00000262
Family Serralysin-like metalloprotease, C-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|75910358|ref|YP_324654.1|
Domain Number - Region: 6180-6270
Classification Level Classification E-value
Superfamily beta-Roll 0.000288
Family Serralysin-like metalloprotease, C-terminal domain 0.0087
Further Details:      
 
Domain Number - Region: 2975-3168
Classification Level Classification E-value
Superfamily beta-Roll 0.000419
Family Serralysin-like metalloprotease, C-terminal domain 0.0021
Further Details:      
 
Domain Number - Region: 4852-5019
Classification Level Classification E-value
Superfamily beta-Roll 0.000715
Family Serralysin-like metalloprotease, C-terminal domain 0.0032
Further Details:      
 
Domain Number - Region: 2074-2151
Classification Level Classification E-value
Superfamily beta-Roll 0.00335
Family Serralysin-like metalloprotease, C-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 2848-2992
Classification Level Classification E-value
Superfamily beta-Roll 0.00837
Family Serralysin-like metalloprotease, C-terminal domain 0.02
Further Details:      
 
Domain Number - Region: 2720-2840
Classification Level Classification E-value
Superfamily beta-Roll 0.0575
Family Serralysin-like metalloprotease, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910358|ref|YP_324654.1|
Sequence length 6581
Comment hypothetical protein Ava_4160 [Anabaena variabilis ATCC 29413]
Sequence
MDANQPLESAPLVNSATNPLTIEGLTANTVTFTGGAAGDSLYLRVNADRLEYSTDNTNYS
SVDAIFTFSSQTQINVNLLAGDDSLFLDASLIQILQTTGGQLSFAGGADADTIFGPGGVN
VNWNITGTNAGNITDIFEFTETENITGRGNDTLTGLNQANLWTITGNGTGTLNDQISFND
IDNLIGGSLQDTFAINGATTVNINAGAGADIFELSNGSTLSGTIDGGTGIDTLNYSADTT
AQQVTLTGLGSSDGFAGTSNLTQQFTNIDNVIGGSGNNTLTGLNASATWEIDGTNRYIST
NNLSFTGFSNLTGGSNADTFIITGNQTADLRGQAGADRFQFNNAANLTGTIDGGTDSDTI
DASAYTTAQQVNLTGLGSSDGFAGTSNLTQQFTNIDNVIGGNASNTLTGLNASAIWEIDG
TNRYISTNSLSFTGFRNLTGGSNTDTFIITGNQTADLRGQAGADRFQFNNAANLTGTIDG
GTDSNTIDASAYTTAQQVTLTGLGGSDGFAGTHSSIIGGFTNISAIAGGTGTDTLIGLNA
SATWEVDGTNRYLSTNILEWNSFENLTGGNQADLFQLSVNPTGLITGGTGEDTLDFSNFP
TAINLTLNGANITGFNGTGTVSFAGIDTIVGSANTRDTLTANPTAFSESEWNLDADPTFS
DRTHTLKFSRIEDLTGKNNIRLSGATVTSTIDQDLTLRYNANTTTIELFNNLTSTVIDST
VITPSVDNLIKVIGTAGADKLTIDASVANAGLAVVFDALAGVDELNLSGFTTPKRTVLEK
NDTNGFSGIGPVAFLGVDKLTGSNVTGDTLEDKTGALISSWQINNISTYDDGTHTLDFTG
FTNLVGGIGIDTFNIIGTQTANLIGGAGADVFRFANNATLTGAIDGGTGADTLTYAEYTS
PRQVTLTSIGSQDGFTGTEATISVNFTNINTLSGGSGNDTLTGINAAANWEIDGTNVYLS
TNSLSFSGWENLIGGNNVDTFVISGTQTVNLTGGAGADTFQFNQSASLIGAIDGGTGADT
LNYAAYTTARQITLTNLGSSDGFIGTETTISNNFTNIDVVVGSSGNDTLTGINAAANWEI
DGTNRYISTNSLDISGVENLTGGSNADTFTISGAQTANIIGGAGADTFQFNDTATLTGTI
DGGTGADTLDYAAYTTARQIALTDLGIRDGFSGTDAAISNGFNNIDTIVGSSTTDTITGI
NAAANWEIDGTNRYLSTNILNFSGIENLVGGSDADTFTISGAQTANIIGGAGADTFQFND
TATLTGTIDGGTGADTLDYAAYTTARQIALTSLGISNDWNGTEAAITEGFKNIDTIVGSS
ATDTLTGINAAANWEIDGTNRYLSTNILNFSGIENLVGGNNVDNFVISGTQIANLIGGSG
SDTFQFSDTATLTGTIDGGTGVDILDYTAYTTNRNVILTTYGQIDGFVGTEDSFDEGYFT
NIDNIEAGTSNSDNIFGVSATALWILNNTGRYESTNIIDVLNPIDRILNFSNFENLIGGA
GTDTFRIEGTQTVNLSGREGTDNFEFADAATLIGDIDGGKDTDKLDFAAYTTARQVALFQ
AGNVDGFVGKESAISNLFFNIDEIIGGTQTDTLIGTNVAADWLLNDTNWYINRNDNDIEP
NDINFSSFENLVGGSETDIFSINGTQTVNIFGQGGADTFLFANGADFTGAIDGGTENDRL
DFSNSNTGVQIALTGLGDSQGWNGQQDENLFFNIDGIVGGSGTDSITGLDEAATWLLEDR
SQAETDWYIIKDESLNDKSLYLDNFEIFAGGSKADAFRVSGTHTINLFGQDGDDSFVFTD
QAVLNGVIDGGAESDTLDFAAYTTARQVTLFTLGIIDGFIGTATGISQNFFNIDAIAGSS
ADDTLTGVDAEATWQIDDGSWYFSNEQQVYLTSFENLVGGIGPDQFTITGTSTINLFGGA
GDDVFQLLDNVGIVGAIAGGTGKDVLDYSFYTTGITVNLTVGSATNITNGIQGIENVTGG
ISNDLIIGDSQDNTLAGSGGNDTLNGGDGDDTLIISVLGISTVDGGNGKDTLVVRGSEDA
DNLEVANNKITTADGTLELVNWTGVEAVEVKTLAGDDVITVSVTDGSPKITLDGGAGQDS
LSSNNQTNVWTMTSGLSGTLTTGDVNPVTINYLDIEKLVGGAGKDTLVVGAFVPPDNRPE
PPKPPEPPEPPEPPEPPRPLPEPIPQQPAPPIPPRPPIILPPIPIPIPIPPIPIPIPIPP
IPIPIPIPPPPPPPPPIPPRPEPPPPIPPRPEPPPPIPPRPTKAEKPDPEEQDPDREEEE
EETPCEATQTFDGGTGENALQAGDCANVWTITGFNSGTLTSGAGIKTFSGIGTLIGGASS
DIFIFSLGGSLSGSIDGGGIALLNSLEAGPGNNDWTIAGSNAGTVTNLASGFKNIATVRG
GLGADTFTLEAGGSLDGSIEGGGLANLNTIKGSNQSLDWTIAGANTGSVTGVSLGFTNIG
NLVGSSSSDTFTLTVAGSLAGSIDGNGGNNTLQGVSVENTWTITSNDTGSIDNIAGTLEF
SDIANLIGGNADDTFILENNSQITGEIVGGGGNNTLQGGSVENTWTITSNDTGSIDNIAG
TTEFSDIANLIGGDGDDTFILEGDSQITGEIAGGGGNNTLQGGNVDNEWTIVTDNMGDLT
NIGSGEITSFREIANLIGGNQADTFTLSEDSHITGTIDGGNGKNTLEGGDSYNTWTITDE
NAGNISNSDGTTNFTEITNLIGGDDDDIFILENNSQITGEIAGKEGDNTLKGGNVRNTWT
ITAENAGYIENRGDNTNFTQITNLIGGNDDDTFILEGDNRITGEISGGGGNDTLEGGNVS
NTWRITDNNAGVVENSTGRTEFNQIAYLTGNDQADIFILEDNSHITGAIAGGGGTNTLQG
DNVRNTWTITAENAGNITNRDGTTNFTQIANLIGGNDDDTFILQGDNHITGEIAGRTGEN
TLQGGDVENNWTISDENAGEIDNQGGRTNFTEISNLIGGNDDDTFILRADNRITGEIAGR
AGDNTLEGGNAENTWTITDENAGNITNNSGSTAFTEIANLTGGNDNDIFILDEDGYITGA
IAGGEGDNTLQGGNVENNWTINAENAGTVDNGNDTTAFREINKLIGGNDEDTFVFEDNGL
SNFDFTVDGGQGDPQLNTLEINADTDLNWLINRQNGGEVSGEDLLLEFDNIANLTGSAGN
DEFKLEDATVAEGGTIDGRAGVNSLSGGITDTTNTWVVNGVNSGNFTATKDGTTYTFDFT
NIQNLNGSDADDVFKLQGGVLYGSGAINGGGGKDTIEQQGSADDDDDDFTTTWTLTDEDS
GTISDSTPETFTVNGQTVTTNLVLRNGFTNIENLVGGADEDVFIVNDGVTFTGNIDAGDG
GDTVIVNGTGTITGSVSGGENTNGTVDVIDLSGIADPVVFNLQDINFSEFEVVIGNNQNS
TIIGSDQPNTWEITGENEVVIENITFIGFNNLVGGAGVDTFNFTAADAVVHIDEEVPPDA
TGEVFSLALITGNLLARLLARNPEDTVTISDVDGTIVTGDESTVIAGNYGRLNINEDGTY
SYAVELSDPAVVNLPVGASLTDTFSYTIEQGTNSITTELIVTIQNTADGLIMTDNVNSID
ITGSISAGGGDDIFNFANDALISAVINSDAGGDNFNFADTAQVVGTVDGGDNLADTSDVV
DFSQASGTVVINLGDNNFNNIETFIGNGIGTTLIASDTNNTWTINVSNGFALEDLGIFGV
SNTLNQGGSNTNIEFNYIGNLTGGSGNDTFKIKSTTLTVNGKEQVDWGVIGKIDGGQGNN
AILMDGINTVGITWEIDGGNAGKAYDQLSLVGGFNSLGQPVPPARFSFDRITFQQPHNLL
DGQTVLYAHEYYLPPDISTPEDINYDLSGLKRGELYTVRRINESTISLVDNQGKTVTGLS
FPSIPGTSITGTHWLTKQVRLNFQNIGDITGDGNNDTFFLRPHGSLSGTIDGGGGNNSLQ
GSDTANIWSIEGFNAGKIFPSTGLTFDGSSSSVVNTGNNITFSYRHNLVTGDRVQYRNGT
NQANGDIGGLVSGDFYQVIRQDDFTVKLTNLSNSNFPISLSPTIDGGNNHELIKTNTFIG
SEGVERNPLLNLGQYDYVAYDSSRVDTTNKTITFSSAHNFVTGDLVQYQYAYQAGETETL
VNREYYRVIRQDNLTIQLTQTGSNIPIDLQSAIPLNGPQFLVKANDVNRIRSSAENIPGL
NVSEFTGEFIEFARPHNLSNGQAVAFRALSDDRSSLNDWNLEKYEEGVGDSIIYYAIKID
DYRIALANSFSNAIGRIPIFLGFDGSMEGQLTPVSNFQRIESLFGGASSDFFSIKNGRIG
GFDTNSGGIFGRGGINTLKQSPSDIWNLRGIDRGETNFVFQFSQISNLIGSNVNDTFIVN
KNARLTGSIDGDSGDNTLQSNSANFVNWTISGQNAGLLQGEQEEQGLSFNRLGGGTILTS
DFRRNHNLVTGQAFSNYFVIKLNNQEIQLAATLEDAFAGQAISLTSDRYSGIPKTAISFN
NITRLEGSDNADTFTIADERVVSSINGKGGNNTLQALNVLNQWLVTGTDAGSLSFSPIEG
NNATINFTNVGNLQGGTERDRFTLAGGTLSGTVNGEGGDDTLAIDSNITTTWTVTGADAG
TVTGITGGFSNIANLKGGNRENTFILDNNGSLSGNIDGGLGADTFIIGGGGSLSGFNSID
GGGFADINTIQIANTNGRPYTWEITGADRGNLQGAINLFSNIGKLVGGSGGNTFIFQPGG
SLSPGGIIDGGRVSSPLNTLQINSTLALNWSINSQDTGLVQGQNFLLSFSNIANLKGGFN
TDTFLMNNAAVSPGGTIDGGTGVNLLLGGFSGITNTWIVNGINSGIFVAPQTTFNFSNIQ
NLNGSNADDVFKLRGGVLFGSGSIDGGGGDDTIEQEENVTTTWTLTGDGAGKVSDATPET
FTVNGVTVTTSEILKDGFRNIENLIGGAEADIFIVNDGVTFTGGVDGGGGSDRFNFNGTS
QITGNIGGGNDDVGGVDLLDFSGFTGTVTIDLNNPALTGIETIIGNGANTTIIGKNTANT
WTVNDANGTVNGLTFTNVHNLRGGSDIDTFNIQSATNAITIDAGAGDDQIKIGNLTPNLG
GTVNNITGALTITGGEGNDQLTIDDSGDTAASTGTLTATTITGLSPSSITYGTVETLNVN
LGSGANNFTVQGTTAVTTIIGGSGDDIIDASASSQAITIFGNAGNDRITGGAGNDRLDTG
TGQDFVIGGAGNDFITVQGTSGGGTTVLGGLGDDRIEIGTPLADAGRVGRTLNNLLAGLT
INGEAGVDTLGVYDDFDTIANTGSITFNNILGLGMAASGLFYIGIENLTVELGDGANSFT
VQNTNPNATTTITGGSGVDTINVQTINSVTTINGDAGNDVINVVSPGAPTVNTIAAGLTI
NGGADTDTITINDSGDTAANTGTLTSTTITGLSPATITYGTAETLNINLGAGADTFTISS
TSATTTINAGVGNDTLNVLAIANATTLNAGIGNDVINVGSATTPTVNGITAALTINGGAE
TDTVNINDSGDTAANTGTLTSSTITGLSSGSITYGTVETLNINLGAGADTFTVSSTSVTT
TINANGGADTLNVEAISNAITLNAGAGNDVINVGSATTPTVNGIAAALTINGGTETDTVN
INDNGDTAANTGTLTSSTITGLSPSTITYGTVETLNINLGAGADSFTVSSSSATTTINAG
GGADTLNVLAIANATTLNADAGNDVINVGTAGTLAANGIAAALTINGGSETDTITINDSG
DTAANTGTLTSTTITGLSSGTITYGTAETLNINLGTGADTLTVSSTGAATTINANGGNDT
LNVQAIANATTLNADAGDDVINVGGGTPNTVNAIAAALTINGGADTDTITINDSGDTANN
TGTLTATALTGLGSNGITYGTVETLNINLGSGSNNLTVQGVSAATTITGGSGNDTINASA
INQAIAIYGNAGNDNITGGGGNDTLDSGTGEDTVTAGGGNDLIYVQGTSGAGTTINGDAG
NDVINIGSSTSNTVNTIAAALTINGGNGIDTVNINDSGDTAANTGTLTSTAITGLSPATI
TYGTVETLNINLGAGADTLTVSSTSATTTVNAGGGNDTLNVLAIANATTLNADAGNDVIN
VGSAEATILNVIASDLTINGGDNADTININNSANTANNSGGLSSTTIDGLGLRRPINYST
VETLNINLGTGADRFTISSTGAVTTINTGGGNDTVNVEAISHATTLNTGAGNDEINVGNR
GLRTVNDIAAALTINGGADTDTVRINDTDDNTNNTGTLTATTITGLSPTTITYGTVETLN
IELGRGADTFTVSSTSATTTINAGDGADTLNVQAITNATTLNAGTGNNVINVASAGTPTV
NGIAAALTINGGPENNSLEVRDSGDTTANTGTLTDTQLTGLGMTGGITYREITNLSIRLG
SGNNNFTIASTFPRTTTSIYGNVGAETFNVRSIRSSTNIFAAGGNDTINVSTSAPNGGGI
VNEILALLFVDGGAGGDTLNVDDRGDGAPNNGTMTANTITGLGMSNGISYTLLEATNILL
GSGNDIFTINSKIPGSSILVDGGPGIDLIFDFTFSAIVRNA
Download sequence
Identical sequences Q3M5H7
gi|75910358|ref|YP_324654.1| 240292.Ava_4160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]