SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910360|ref|YP_324656.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910360|ref|YP_324656.1|
Domain Number 1 Region: 45-107,138-204
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000175
Family PDEase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910360|ref|YP_324656.1|
Sequence length 291
Comment hypothetical protein Ava_4162 [Anabaena variabilis ATCC 29413]
Sequence
MFNATEILIDAFVNQIREGYTRTYGCLKNDYQDIIAWAGSMALENIANSDALYHNVEHSV
LVTLVGQEILRGKHIREGGVSSEDWLHFIISLVCHDIGYVKGVCRQDQEHAGLYATGDNG
RMISLLPGASDASLTPYHVDRAKLFIDERFGGHKLIDAEVIKSNIEWTRFPVPTAEDHQE
TTNFAGLVRAADLIGQLSDPRYLKKITSLFYEFEETGINKVLGYETPADLRKNYAKFYWN
GVHPYIKDGLRYLSLTQQGKQIMANLYSNVFVVEHERTQEEHLYLVEQLHA
Download sequence
Identical sequences A0A1W5CF08 A0A1Z4KU33 Q3M5H5 Q8YWP9
gi|17229047|ref|NP_485595.1| 392368 103690.alr1555 240292.Ava_4162 WP_010995724.1.33676 gi|75910360|ref|YP_324656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]