SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910407|ref|YP_324703.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910407|ref|YP_324703.1|
Domain Number 1 Region: 8-349,1011-1259
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 1.35e-199
Family RNA-polymerase beta-prime 0.000000056
Further Details:      
 
Weak hits

Sequence:  gi|75910407|ref|YP_324703.1|
Domain Number - Region: 467-656
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0628
Family Pectate lyase-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910407|ref|YP_324703.1|
Sequence length 1355
Comment DNA-directed RNA polymerase subunit beta' [Anabaena variabilis ATCC 29413]
Sequence
MTNEKMIFRNRVVDKGQLRNLISWAFTHYGTARTAVMADKLKDLGFRYATRAGVSISVDD
LMVPPSKRSLLEAAEEEIRATEVRYQRGEITEVERFQKVIDTWNGTSEALKDEVVTHFKQ
TNPLNSVYMMAFSGARGNISQVRQLVGMRGLMADPQGEIIDLPIKTNFREGLTVTEYIIS
SYGARKGLVDTALRTADSGYLTRRLVDVSQDVIIREIDCGTTRGIPVRPMTEGSKTLIKL
STRLLGRVVGEDVIHPKTKEVIAARNTPISDDLAKEIEKAGVAEVVVRSPLTCEAARSVC
QHCYGWSLAHAKMVDLGEAVGIIAAQSIGEPGTQLTMRTFHTGGVFTGEVAQQVRSKMDG
TIKLPRKLRTRTHRTRHGEDALFVESNGIMILEPRKEGSETPAPQEIHVTQGSTIYIVDG
QQVKQGQLLAEVALGGRTTRTNTEKAVKDVASDLAGEVKFAEVVPEQKTDRQGNTTTTAA
RGGLIWILSGEVYNLPPGAELVVKNGDRVETNGVLAETKLTTIHGGVVRLPEATPGKSTR
EIEIITASVVLDQATVTVQSSQGRNNYLITTGNNQVFNLRATPGTKVQNGQVVAELIDDR
YRTTTGGFLKFAGVEVQKKGKAKLGYEVVQGGTLLWIPEETHEVNKDISLLLVEDGQFVE
AGTEVVKDIFCQNSGVVEVTQKNDILREVVVKPGELLMVDDPEAVIGRDNTLLQPGEELL
GQVATELRYIQYVESPEGPALLSRPVVEFAVPSNPDVPSTTSVSQQTGRSIQMRAVQRLP
YKDSERVKSVEGVELLRTQLVLEIEQEGEQEHNASPLAADIELIPDPEDADVQRLQLVIL
ESLVLRRDIAADATQGSTQTSLEVKDGDTIVPGSVVARTQILSKEGGIVRGVQKGSEAVR
RCLVLRHSDMTTLNTSAKPKVKAGDLIVAGTELAPGVFAEESGQIVAVKNAGESTTTQDA
ALSTQNYAVTIRAGRPYRVSPGAVLQIEDGDLVQRGDNLVLLVFERAKTGDIIQGLPRIE
ELLEARKPKEACILAKRGGEVKVVYGDGDEAIAIKVIESNGVVTDYPLGPGQNLAMPDGS
VVPAGQPLSDGPSNPHEILEVFFSLGSEDGVYACASHALQKVQTFLVNEVQMVYQSQGID
IADKHIEVIVRQMTNKVRIDDGGDTTMLPGELVELRQVEQVNEAMAITGGARAQYTPVLL
GITKASLNTDSFISAASFQETTRVLTEAAIEGKSDWLRGLKENVIIGRLIPAGTGYNTYD
EPGMLEDYSTLETTSVLDETDDPLDMVLDDRTARAYNLDSPGLAETGFSNRRSILDDDEL
IADEIHDLVEAEVEVDDEVDDDYEDDDEDDDDYED
Download sequence
Identical sequences A0A1W5CF95 Q3M5C8
240292.Ava_4209 gi|75910407|ref|YP_324703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]