SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910411|ref|YP_324707.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910411|ref|YP_324707.1|
Domain Number 1 Region: 27-382
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-44
Family Cystathionine synthase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910411|ref|YP_324707.1|
Sequence length 409
Comment Cys/Met metabolism pyridoxal-phosphate-dependent enzyme [Anabaena variabilis ATCC 29413]
Sequence
MNSLEQLRQAEQALLEIFSGIDAQVKQNLKRVLEAFRNQRVGAHHFAGVSGYGHDDLGRE
TLDKVFAEVMGAEAAAVRVQFVSGTHAIACALFGVLRPGDEMLAVVGSPYDTLEEVIGLR
GQGQGSLIEFGIKYRQLELTSQGSIDWQTLSTSITDNTRLVLIQRSCGYSWRPSLSIADI
EKVVNLVKQQNPDTVCFVDNCYGEFIETQEPTHVGADLMAGSLIKNPGGTIVTAGGYVAG
RADLVEAAACRLTAPGIGSYGGATFDQNRLLFQGLFLSPQMVGEAMKGTHLTGYVFDKLG
YPVNPAPLAPRGDVIQAIKLGSGKKLIAFCKAVQQNSPVGSYLDPVPDDMPGYESQVVMA
GGTFIEGSTLEFSADGPLREPYVVYCQGGTHWSHVAIALEAAIDAVGEA
Download sequence
Identical sequences A0A1W5CF67 Q3M5C4
240292.Ava_4213 gi|75910411|ref|YP_324707.1| 390456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]