SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910462|ref|YP_324758.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910462|ref|YP_324758.1|
Domain Number 1 Region: 50-330
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.25e-33
Family TK-like PP module 0.0049
Further Details:      
 
Domain Number 2 Region: 374-580
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.57e-33
Family TK-like Pyr module 0.029
Further Details:      
 
Domain Number 3 Region: 586-735
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000179
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910462|ref|YP_324758.1|
Sequence length 737
Comment transketolase, central region [Anabaena variabilis ATCC 29413]
Sequence
MTAITPKASSALPEFAEGIQYFGEALPDFETYGATPAIESGKVAIAAPTNPQAVYQTLLA
ADALRYLTLQITGSKASGHPGGFASQAEAYAALVMLGYKNIITEVGHHAPGFYSAMFLDR
SLEDMGISTVQQLRDRFREKHGLLGHLSGYIPGILAPAGPLGQGQHFAMAAALLHRDKLF
PFTLGDGGLGEPYIMSSMAHFNTAYPSVTNFLPVLVWNGYSQEHHSMVSLKTNAQMTAYW
QGNGFEEVVLVDAKEFDDQNQPGDYVDSTIFSFTQRLAFTQAVLVAVDKAARSALGGKLT
VFIIKQLKGAGVHAKGAKSHNLYPKDTLDAPHIITALQKRALSPAAWQTVRTNAERAGGG
PASKTVVTEFELPLPDLGTLPLEEYAVGGEPKVSTTAMGRIVGAVGQKDPNFLVTNADGN
EASGIGNINQALKIIHPTTDDLYNQAPNGQVYEPLSEDACAGLAVGLSLMGARTLWCSYE
SFAINGLPIWQTVIQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIEAYFASMMRN
GNVFPVFPPDANSTQVCYDWALTTKNKGIVITASKSPLPIRTTFAQTRQGLEEGAVVLHE
IPGGKQVVFAVIGDMTLIPVFEAAAFLETEGIGVKIVSVINPRRLYRPHDVAWDTCSEAD
NGFIDDAKFAELFAGDALIGVTGGVASMLEPIMLRSNSKRDTFAWKRGETTASAGELMAF
NGLTAEALTKRAIELVH
Download sequence
Identical sequences A0A1W5CK18 Q3M573
gi|75910462|ref|YP_324758.1| 240292.Ava_4264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]