SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910593|ref|YP_324889.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910593|ref|YP_324889.1|
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.88e-42
Family N-acetylmuramoyl-L-alanine amidase-like 0.00049
Further Details:      
 
Domain Number 2 Region: 260-311
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000445
Family Peptidoglycan binding domain, PGBD 0.0026
Further Details:      
 
Domain Number 3 Region: 177-254
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000377
Family Peptidoglycan binding domain, PGBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910593|ref|YP_324889.1|
Sequence length 313
Comment peptidoglycan binding domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MRYGIDIGHNCSPDTGARGIKFEDNLTLDVGNRVISKLKALGHEVISCKPDRATSVKDSL
SQRCNKANANKVEVFVSIHFNAFNGQANGTEVFATSDNGRRIAKPVLDEIIKLGYFNRGV
KSGSHLFVLRNTNMPAILVECCFIDAQKDMNLFDPEATANAIVKGLTGKLPTTPVPSVPD
EEQNIDTSILRLQKSLNRLKITDRSNKSLVENGQLNAETKFAIERFQGIVGLEKTGIVNE
ATWNAINLILAKRIIRQNHAGGPVVRYLQFRVGVEVDGIYGAQTEAAIKRFQRQNGLLAD
GIIGPMSWQKLIG
Download sequence
Identical sequences A0A1W5CLB8 Q3M4U2
gi|75910593|ref|YP_324889.1| 240292.Ava_4396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]