SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910842|ref|YP_325138.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910842|ref|YP_325138.1|
Domain Number 1 Region: 238-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000112
Family Clostridium neurotoxins, the second last domain 0.073
Further Details:      
 
Weak hits

Sequence:  gi|75910842|ref|YP_325138.1|
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000837
Family Leech intramolecular trans-sialidase, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910842|ref|YP_325138.1|
Sequence length 494
Comment hypothetical protein Ava_4646 [Anabaena variabilis ATCC 29413]
Sequence
MVRSQQNPQKYNWIFFLVSVFIVLIATLYPFNFSKIVKFSITEIIASFNNSSSFQDQVNN
ILLFLPVGWTFGNLCQNSIKKITLQIFFVILVSFGLSLTVEFLQIFLPSRSPTPADLLNN
SLGGLFGFIGFSIWNAKSFSSTVEKLESSRVSKSSKLIICFFCGYLVLTLFISLFWQGTT
NLSNWDSNYYLSVGNEITGNKAWAGYVSEISIVDRAISKNEASQTLADANYLHKLGNSLV
AHYKLNGECCYQDQTGNQPELLWQGRSASTSKSQGAFLDAHHWLKTSTPVSHLSQRMSQT
SEFTISTAIATSNLNQKGPARIISVSGSSQRRNWTLGQQGNSLDFRLRTPLTGENGTELK
LNIPNVFTDTYLHHLVITYSRGNIQIYVDKLENFHSFSLLDLIPKEQRIFYYALTFMPLG
IGLGIITFLARKKLIFYRILFYSGILIPSLMLEGILVSESGKDFSIKHLLLGISFTAVTM
IFLRIRAARLKTIS
Download sequence
Identical sequences A0A1W5CAY0 Q3M443
gi|75910842|ref|YP_325138.1| 240292.Ava_4646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]