SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910921|ref|YP_325217.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910921|ref|YP_325217.1|
Domain Number 1 Region: 6-316,344-418
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.26e-33
Family Pectate transeliminase 0.087
Further Details:      
 
Domain Number 2 Region: 536-647
Classification Level Classification E-value
Superfamily CalX-like 7.72e-31
Family CalX-beta domain 0.0007
Further Details:      
 
Domain Number 3 Region: 423-535
Classification Level Classification E-value
Superfamily CalX-like 8.11e-30
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 4 Region: 649-758
Classification Level Classification E-value
Superfamily CalX-like 3.79e-29
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 5 Region: 825-1013
Classification Level Classification E-value
Superfamily beta-Roll 1.01e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910921|ref|YP_325217.1|
Sequence length 1037
Comment polymorphic membrane protein [Anabaena variabilis ATCC 29413]
Sequence
MAITILTVNTTTDQNDGSAANGLSLRDAILIANANPNTEYEIRLTGGVTYNLTSNGINED
NALTGDLDIKSRNNVLYIVSVGGEKATIDASGLLNSDRVFHVLNGGALSLQNVVVTGGKI
SNDGGGIRVDSNGYLDLYNTNVSGNSAEGGNWGGGIYNNNGTVYLRNGSTISNNQALNGG
GILNSGTLITIDSTISNNNSGSGGGIYNFDTLTVINTTVSNNSARGSGGGIQGNGSFSSI
ALVNTTISGNTAGSGGGGIDSTGGSVTNILNSTITNNTAGILGGGGIRGSANLKNTIVAG
NFGNYDYQGTGKDIQGTVNGNNYNLIGSLAGASGTVGTGTDIVNPNPGLGPLQNNGGLSL
THTLLAGSPAINAGNNNLIPADAEDIDRDGDTTEPTPFDQRGLARVSGGTVDIGAFEVQS
ATLPTITINNVTVTEGNTGTTNATFTVTLSAASTSAVTVNYATANGTATAGNDYTSNTGI
LTFNPGETNKTITVAVRGDTIAEPNQTFFLNLSNSLGATIADNQGLGTITDDDANPTIAI
ADVSRNEGNSGTSNTTFTVTLSAASEKTITVNYGTANGTATAGSDYTSTTGTLTFNPGDT
SKTFTVAVTGDTTVEANETFFVNLSNATNATITDNQALATILNDDTATLPTLSINDITIV
EGQSSQAVLTVTLSSASSQPVSVNYSTVAGTATANTDYTSRSGTVTFAANTTTATITIPI
LNDNLNEANETLRVNLSSPTNATIQKASGTVTITDTLQASVTTTLAEGIENLTLLGSSNI
NATGNSSNNTLTGNSGNNILTGGNGDDTYNFNASTPLGSDRIQEITTGGNDTISFAGTNN
AARVNLGTIATQTINSNLKLTLSANNVIENVVGGNGSDRLIGNSLNNTLTGGNGNDVLTG
RGGADTLIGGSGNDILTGGTESDRFLYSSGRAFTSNDFGIDILTDFTSGSDKLVLSKRTF
TALSSVIGDGLSQVSDFTTVEDDDLAATSTAFLVYSIGSGSLYYNQNGSAAGFGTGAELV
NLINLPSLTAADLAIVA
Download sequence
Identical sequences Q3M3W4
240292.Ava_4725 gi|75910921|ref|YP_325217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]