SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910924|ref|YP_325220.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910924|ref|YP_325220.1|
Domain Number 1 Region: 2157-2332
Classification Level Classification E-value
Superfamily beta-Roll 3.36e-33
Family Serralysin-like metalloprotease, C-terminal domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1738-2052
Classification Level Classification E-value
Superfamily DNase I-like 1.87e-32
Family DNase I-like 0.074
Further Details:      
 
Domain Number 3 Region: 496-605
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000000497
Family Lamin A/C globular tail domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|75910924|ref|YP_325220.1|
Domain Number - Region: 197-317
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000275
Family Lamin A/C globular tail domain 0.024
Further Details:      
 
Domain Number - Region: 1358-1465
Classification Level Classification E-value
Superfamily CalX-like 0.000405
Family CalX-beta domain 0.0082
Further Details:      
 
Domain Number - Region: 805-895,950-974
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 0.000955
Family TolB, C-terminal domain 0.034
Further Details:      
 
Domain Number - Region: 384-490
Classification Level Classification E-value
Superfamily CalX-like 0.0405
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910924|ref|YP_325220.1|
Sequence length 2346
Comment endonuclease/exonuclease/phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MTATTLKPGDIAIAGYNTTNPDSIRVVVLVDIGAGTTFNITDNGWQSSGSFRTGEGVLTY
TAPQDISAGTVLTWTNGSSINSPGFNSNNPSNFALNASGDSLIIYTGTLASPTLIYSLSS
GNWTNATSASTSAEPTATNGGTLETGKTTVAITTNGTNGYYSGSTVGTQAQLLAAISNPA
NWTASSTITDIANWRSSFTLSQPLPNIQITEYMYQGTNGEFMEFTNLGTTAVDFTGWSYD
DSGRTAGTVSLSAFGIVQPGESVILTEASEADFRAAWGLSANVKVIGGLTRNLGRSDEIN
LYDNNGQLIDRLTYGDETFTGTIRTQTRSGWTEPGNLGAVTINTDWQLSTVDDAQNSRTS
TGGDIGNPGFYNINNTPLPGITITQSGSSTDVTEGGVTDSYAIVLKTQPTADVTINITVD
NQVTTSSPTLIFTPQNWNIAQTITVTAVNDDVIEGTHTSTIAHNVSSSDTNYNGIAIANI
NINITDNDAPPNTNVNVQITEYMYTGANGEFVEFTNLGTTAVDFTGWSFDDNTRIAGSFN
LSAFGIVQPGESVILTETAAETFRTAWNLPTSVKIIGNSNQGLGRTDEINLYDSTGQLID
RLTYNDEGFTGTIRTQNASGWTTAANLDGFEITTNWQLSAINDGQNSRLSTGNDVGNPGT
YIPNPVSTVGAPKIEVNPSTTDLLDGQNLPVPLPKIGAGAISGVINDPTDPARTLGINFT
LSDTDTPVENLTITVTSSNQAVVPDANLTLTGTGAERNLKINPVGVGLANITVTVSDGTL
SSAYIINYAASAGSVSPSTRFLTGTSDASSAIAIDANYMFVADDEDQTIRLYDRRNSGLP
LASFDFTSLLGLSGSSEVDIEASTRIGNTIYWLGSHSNNSNGSDSPNRERIFATQISGTG
ASATLTFQGYYQFLEDDLIAWDNNNGHGLGAGFLGLAGSAANGVSPEIRNGFNIEGLTVA
PDGNTAYVSFRAPNQPTSDRTNALIIPVTNFTNILNTTGGTSGATSFGAPIFLDLGGRGI
RSIERNSSNQYLIIAGPPGGATGVAPNDFRLYTWTGNATDAPVLRIADLTALNTNGSFES
IVEVPDSLTNNTQIQLLVDNGDTVWYNNGTISKDLAQNNFQKFRSEVITLGSPVLTLPVG
AISLKTPYSQEFNNLISSGSETWTDSSTIAGWYTARTGTGTTIVASTGSNTAGNLYSFGL
DSSDRALGSIGSGNAAAGTFYWGSRFFNDTGNVVNQLYVNYYGEQWRSGGTTSNPQTVDF
QYQTGATSLTGGTWVDVNNLDFTSLINNTTAGALNGNASANRNLISGTISGLSLNPGEEI
WLRWVDIDHPGTDHGLSIDDVKVSTAPLPSITLIESGGSTNVTEGGATDTYTIVLNTQPT
ANVTVTINPDSQTTTSVNTLTFTPANWNTPQTVTITAVNDDLVEGTHTSVITHTVTSDDT
SYNGINIGSVTATITDNDVALTITKIHQIQGSGTTFNSAFGSIRTIEGVVVAAFPGGSGL
NGFFVQEEDADADNDSTTSEGIFVFDPTGQFSGSVGDKVRVTGSVSEFSTNNGVSSLTQL
SSVSSIINLGADILPTVSNIQLPVTTVADLERYEGMRVNISAGSGDLTVTEHFQLGRFGQ
VVLSATGTSNQLGTDGRLEQYTQFNDPSVTGYAAYLDEIAKRRIILDDGSSTQNPATIIF
GRGGEPLSATNTLRGGDTVASITGILDHRFEGYRVQTSTGVNFTPANPRPTTTPDVGGTL
KVASFNVLNYFNGDGTGSGFTSPEQRGAENLTEFNRQRDKTIAAILGLNADVVGLIEIEN
DGYGANSAIQDLVNGLNAVAGAGTYAFINPGLSQLGTDAIAVGLIYKPNSVTPIGTAATV
ADGFGQGAFDNNNRKPLAQTFRQNSTGEQFTAVINHFKSKGSSFGNPGDADAGDGQGLSN
GTRTRASQDLAAWLATNPTGTTDTDYLILGDLNAYAQEDPIRALENAGYNNLLPNTTYSY
VFDGQWGALDHALANASLTAQLSGAVKWHINADEPNVLDYNTNFKSVGQQTSLYSPDAFR
SSDHDPVIVGLNLNTAPIAVNDIATTNENTAVNINVLTNDSDANGDALQLSLVSNPVNGI
AVVNDNGTPGNFADDFIIYTPNTGYVGSDSFTYGISDGKGGTATASVSLTINASGGIIGT
PDNDILTGTNRNDLIRGLGGNDLLIGGNGNDTLYGDRGKDILLGGNGNDTLYGGDGNDTL
IGGNGDDLLVGGKENDLLIGGNGRDRFYLSDTRTGEFDIITDFKVGQDTIFISKTEFGLS
QALGTLNPGLFRLGSNATAAGDRFIYNNTTGQLFFDEDGIGGAAKIQIGLLSNKPAITSS
SITIAA
Download sequence
Identical sequences A0A1W5CB63 Q3M3W1
240292.Ava_4728 gi|75910924|ref|YP_325220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]