SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910926|ref|YP_325222.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910926|ref|YP_325222.1|
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.41e-60
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910926|ref|YP_325222.1|
Sequence length 252
Comment thioesterase [Anabaena variabilis ATCC 29413]
Sequence
MKTNTSSYNSWVICPKPNPVAASRLFCFPYAGGSSFIFRTWPNYLPASVEVCAIELPGRG
RQIQLAPFQKMEPLVDAIASAIYPYLDKPFAFMGHSMGGLVSFEVARFLQKQYDIHPVHL
FISGRRPPHIPNLHPPIHNLPEPAFIEELRHLNGTPSTVLENSELMQLFLPILRADFAVL
ETYIYTPELPLECPITVFGGLQDSEVSGDELQAWQEQTKADFNLHMFPGDHFFLHSAQSL
VLEQLARYLSGI
Download sequence
Identical sequences A0A1W5CB40 Q3M3V9
240292.Ava_4730 gi|75910926|ref|YP_325222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]