SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910941|ref|YP_325237.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910941|ref|YP_325237.1|
Domain Number 1 Region: 28-405
Classification Level Classification E-value
Superfamily Thiolase-like 8.05e-110
Family Thiolase-related 0.0018
Further Details:      
 
Domain Number 2 Region: 559-690,754-855
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-75
Family FabD-like 0.00025
Further Details:      
 
Domain Number 3 Region: 1068-1231
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.34e-23
Family NRPS condensation domain (amide synthase) 0.022
Further Details:      
 
Domain Number 4 Region: 1243-1488
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.78e-18
Family NRPS condensation domain (amide synthase) 0.015
Further Details:      
 
Domain Number 5 Region: 689-753
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000068
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0036
Further Details:      
 
Domain Number 6 Region: 1510-1580
Classification Level Classification E-value
Superfamily ACP-like 0.00000000811
Family Acyl-carrier protein (ACP) 0.029
Further Details:      
 
Domain Number 7 Region: 933-1018
Classification Level Classification E-value
Superfamily ACP-like 0.00000000903
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910941|ref|YP_325237.1|
Sequence length 1587
Comment beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
Sequence
MQTQDLTPLQKAIIALKEARTKIESLERTQSEPIAIVGMGCRFPGDANNPEKFWELLHQG
KNGITTVPPQRWDIDAYYDDDPDVPNKMYARHGGFINNVDQFDPQFFGITPREAIALDPQ
QRLLLEVSWEALENAGIAPQKLTGTQTGVFVGIGIDDYAKRQIKHHIPIDAYTGSGNAFC
FAAGRLSYLLGLQGPSLAIDTACSTSLVTIHLACQSLRNGECNLALAGGVSLMLSPEVTL
YLSKTRALSPDGRCKTFDRDANGYVRGEGCGMVVLKRLSSAVADGDHILAVIRGSAVNQD
GASSGLTVPNGTAQQAVIRQALANAKVTPEQISYLEAHGTGTALGDPIEVRAIDNVFGKG
RSPNHPLILGSVKTNIGHLEIAAGMASLLKVILSLQHQEIPPHLHFQELNPDLAASAKSL
KIPTSVIPWQPTEQPRMAGISSFGLSGTNAHIIIEEPPQLTVTQAEVDRPLHVLMLSAKS
EAALHTLAADWENLLRNHPETNFADLAFSANTGRGSFNHRLAIVAQSTAQARQNLAAFNQ
KQPSLNVFSQEVEKGRQPKIAFLFTGQGSQYVGMGRQLYETQPTFRQALDECDRLLQPYL
KESLLSVLYPQTPTANPLVNQTAYTQTALFAIEYALCKLWQSWGIQPQGVLGHSVGEYVA
ACIAGVYSLQEGIELIAQRGQLMQALPQTGTMAAVFAPVETVARAIAPYGNEVTIATINS
PENVVISGVKAAIAAVQADLIAQGIDVRPLQVSHAFHSPMMEPMLGEFKQVAAKINYQTP
RIDWISSVTGAEITHSIDAEYWCQQIRDCVQFAPAIATLAQQGYDLLMEIGPHPVLTRLG
KQTLSDPQILWLSSLHREQDNWQSLLQSVATLSVHGVALDWSGFEQDYVRRRLLVPTYPF
QRQRYWLAETEFIQPEVVPVAAISPETSKIVAATETLESQILSLVAKITGMNPQQLSLDA
TLEGGLGLDSIMMTQLMNGIIKFIPPGQRESFHQVFSLRDLMQISNLGELLKVLEPWQTV
DLQETTAVDVIPSADIPTIDQTSDVVDILHSQLPLLVSYWSLNSNSLFTKVQVAGDFNLE
IAQHSWQKLIDRHPMLRARFHIPQGATSFADYQLQVLKNPSPPAIPLKDIRHLASEEQTQ
AIAQEVHHWLNYRWSLTQWPLHKFSVLQLSDSVYQMFLGNEHLIADGLSNHVIIREFLEI
YRACIDQDTPDLPPALSVADYQAQVQAMNAWQDVDEDRALAAYNNSQRHTAYLWNPQQQI
RQQTPLFDNQKYILSAETTAKLITKTREWRVPMNTLLLGAFIQTVSKLDTTSEKIGIQIP
TSGRVYPGVDASGVISSFAQNLALSFTPPQAQQDWQTFLTEIQQTVQQHIGSGLDRAQTR
QMGVIFRDSFVLENGRIPDHSLSLIQGALKSNLYLPYTGQTHIHHYYGSLSVTEYQAGGM
NASGTIDILQEIFDSRLHLFASYDSNTFDLSVIDSLMKSYLAQIEELATLPIEEQVSSAF
VSPIFINKDIGKNLRQITSEICHWAIEESEMSDDLEADLGLDSLELIRLVTRLESVYGKN
YRQCLLNCRTLEEMVVVLSAESLAISA
Download sequence
Identical sequences A0A1W5CB84 Q3M3U4
240292.Ava_4745 gi|75910941|ref|YP_325237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]