SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910942|ref|YP_325238.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910942|ref|YP_325238.1|
Domain Number 1 Region: 9-529
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.76e-151
Family Acetyl-CoA synthetase-like 0.0000000432
Further Details:      
 
Domain Number 2 Region: 549-722
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.56e-27
Family NRPS condensation domain (amide synthase) 0.011
Further Details:      
 
Domain Number 3 Region: 732-970
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5e-22
Family NRPS condensation domain (amide synthase) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910942|ref|YP_325238.1|
Sequence length 983
Comment amino acid adenylation protein [Anabaena variabilis ATCC 29413]
Sequence
MTFTLEIPYYQIIQQAQLTPDAIAVFDETNPLTYQQLDRLSNQVATYLRTQGVAPNTRVG
IMAERGARMMIGILGILKAGGSYIPLDPGYPTDRLRYILEHATIQTLLTEHQVSPQLVAC
VQEALPLQTVMFLDEGEPLEEIQSLNQITAETWQGLSKDTLELCNSPDDLMVILYTSGST
GRPKGVMLNHRGYMNRLTWMQNTFSLQPGDRVAQRTSFCFDISVWEIFWTLMSGATICPV
QREVVLNPWEFAQWIQQTQINVMHFVPSLFGEFISALENETWSFPQLRWLMFSGEALPMS
FIQRWIDRHGLKTGLANLYGPTEASIDVTCHLITERPDERVTTQIPIGKAIDNVYLRVLD
EGMQPVQPGNTGELWLGGVQLALGYLKDPEKTAQAFCPNPFTDIPGDYIYRTGDLVKELS
DGTIEYHGRIDHQVKIRGFRIELGEIESVLTTHPDVREAAVLAVDYGEGQKRLVACISGN
KIKNRFLKEYLEQKLPHYMIPQRFLWLDSLPKNHNGKLDRKTLVAQLTSDSSPSSDSSPS
LLPLLPLGPAQSWLVKYFEPPYQWLGYTRFLYHQSLNVDIFNQAVNFLIHRHDAFRTVFV
QNQGQWQQHILNQTPSFVSEYWDGSQVSPEERNLKIEQYMEVVAKQIQLDRWPMTAAIVV
KVSPTCYDITMIAHHMITDMLSATILFKELWSAYHQLLLGVSPTFPQAKSESYEDFIQLL
VNEDNKGTFEHHIKYWQSQFPDTTSRFEIPIDHVKGANIEASAEKECFRLSQQQTELLLN
QGKSYYGSNVYLILLAPLYRLMANWSHRPGVVISHRSHGRDLGQGSTFMESMGNYAINFP
LGITLDSSAIWQKIIQEISDRFQSLPMNGVTYDWIGDRLPEYLYPDSNLTSIRVNYLGNR
SAPPSNLFEFIQTVRDCRLSLPDQKRTTLIEFFLLVADGHLEITIEYSRNFHLATTIQSL
GKQYLLLLEDILTPVSMSQPPLR
Download sequence
Identical sequences A0A1W5CB72 Q3M3U3
gi|75910942|ref|YP_325238.1| 240292.Ava_4746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]