SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910943|ref|YP_325239.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910943|ref|YP_325239.1|
Domain Number 1 Region: 14-135,191-416,449-467
Classification Level Classification E-value
Superfamily Thiolase-like 3.68e-70
Family Thiolase-related 0.00018
Further Details:      
 
Domain Number 2 Region: 587-725,793-895
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.14e-59
Family FabD-like 0.00023
Further Details:      
 
Domain Number 3 Region: 1184-1263
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000017
Family Acyl-carrier protein (ACP) 0.014
Further Details:      
 
Domain Number 4 Region: 729-792
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000000811
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910943|ref|YP_325239.1|
Sequence length 1272
Comment beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
Sequence
MVDQQLNPKKSVLQQTPIAIIGMSALFAKAENLQQYWENILAKINCISEVPETAWSLKDY
YDPDPSTPDKTYARAGGFIPEIDFDPLEFGLPPDTLEALDSANLLALVLAKQALKDAGYG
EGKEFNRETTGVILGASGLWKSITPLTARLQYPLWEKVLKNSGLSAEQTEKIIEKMQAAF
VPWTENSFPGMLPNVVAGRITNRLDLGGTNCVVDAACASSLSALKMAISELIEGRCDMML
SGGFDTDNSILNYMCFSKTPAFSKKDYLNPFDATSDGMMVGEGLGMLVLKRLADAERDGD
RIYAVIKGIGTASDGRYKSIYAPRTEGQVRALRRAYEDAGFSPATLGLMEAHGTGTPAGD
FCEFTALNQVLTENQAGRQQIALGSVKSQIGHTKAAAGAASLIKATLALHHKILPPTINV
TQPNPKFKIEESPFYINTETRPWIQNGDTPRRAGVSSFGFGGTDYHVVLEEYTPKFPQGG
DRIHSTAQSILLWADTPQQLSQKCQATLEQLQSDNCGEQYHQLQHHSKTALIPETSARVG
FVATSLEEAQKLLKAAIKQLQIQPQAEAWEHPQGIYYRQTGLSLKGKVVALFPGQGSQYL
NMGREVSLNFPEIQQAYQALDQLMAQDNLPALSDIAFPIPAFNPEVIKQQSQQLQRTENA
QPAIGALSLGLYKILQNVGFKPDFVAGHSFGELTALWAAGVFSDEDYCYLIKARGQAMTV
PQGSHDCDRGTMLAVSGDVAKIKQLIAGMAKVQIANYNAPEQVVLSGSKPEIATLEKVLS
KQGYTVTPLPVSAAFHTPFVHHASQPFAEALNRVTFNTPQIPVYANMTGNAYPTEATAIR
KLLEAHLLNAVQFAQEIENLYAQGGYCFVEIGSRQILTNLVKQTLGDRPHVAIALNPSRQ
KDSDVQLRQGVIQLRVIGLSLKDLDASPRKLPAQKSKSKGLSIKLNATNYISDKTKAAFE
SAFKPEPVVQLASTPLDQVVSDAATVVLDSPAQTFVASTNDEVPITPVSVMEESVSLGEI
YHQSDYQFIISKDETNIMNNSTHNTIAYLFQQFYQHQKEMLQVHEQYVKTQSQSFQAFLQ
LLQQQEVMIPQSSTIAEQTVVVPAPVVQLPKTPAAPIVEPPQTPVVPVAELPKTPVAPVV
EPPQVTPVAEPVHISHIASYLEPRYSAPAPQPTPVVTETASPAANESYISRALMEVVSDK
TGYPTEMLELEMDLEADLGVDSIKRVEIMGTLHESFPQLPKLSPEELAEKRTLAQIVQYL
AGQIMVAEKKIA
Download sequence
Identical sequences A0A1W5CB85 Q3M3U2
240292.Ava_4747 gi|75910943|ref|YP_325239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]