SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910980|ref|YP_325276.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910980|ref|YP_325276.1|
Domain Number 1 Region: 24-206
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.16e-23
Family TrmB-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910980|ref|YP_325276.1|
Sequence length 215
Comment tRNA (guanine-N(7)-)-methyltransferase [Anabaena variabilis ATCC 29413]
Sequence
MSALPFVRVRQHVNPLAQKYLTPANPLEWEKVYSSPHQPLHLDIGCARGRFVLQMAQVEP
RWNFLGLEIREPLVIEANQFRSQLGLSNLHYLYCNANNSLQPLLSSLPTGILQRVTIQFP
DPWFKTRHAKRRVVQPELVQDIANYLAVGGVVFLQSDMEFVAVEMCDRFAANPAFKKVGS
GEWLSENPLPVATERETTTQNRGEPVYRALFERIS
Download sequence
Identical sequences Q3M3Q5
240292.Ava_4784 gi|75910980|ref|YP_325276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]