SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75911185|ref|YP_325481.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911185|ref|YP_325481.1|
Domain Number 1 Region: 40-211
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.77e-73
Family HD domain 0.00000194
Further Details:      
 
Domain Number 2 Region: 201-416
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.49e-62
Family RelA/SpoT domain 0.0000147
Further Details:      
 
Domain Number 3 Region: 399-471
Classification Level Classification E-value
Superfamily TGS-like 1.11e-22
Family TGS domain 0.055
Further Details:      
 
Domain Number 4 Region: 668-746
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000802
Family AF1403 N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75911185|ref|YP_325481.1|
Sequence length 751
Comment (p)ppGpp synthetase I [Anabaena variabilis ATCC 29413]
Sequence
MSSIAISSPTDLSLPEWLKQCLRDSSTYGSKAENDRMCSDNTLICRAFDFAYQLHHGQYR
KSGELYISHPIAVAGLLRDLGGSPAMIAAGFLHDVVEDTDVTIEEIEERFGPEVKQLVEG
VTKLSKINFKSKTESQAENFRRMFLAMAQDIRVIVVKLADRLHNMRTLQYMSEDSRRRSA
QETRDIFAPLANRLGIWRIKWELEDLAFKNLEPEAFRQMQKYVSEKRDAREEKLAKATAI
LRDRLQQAGIRCLDISGRPKHLYSIYQKMHRQQKEFNEIYDLAALRIIVETNEECYRALA
VVHDAFRPIPGRFKDYIGLPKPNRYQSLHTGVIGLTGRPLEVQIRTMEMHRIAEYGIAAH
WKYKETGGSNSLITTSDEKFTWLRQLLEWQSDLKDAQEYLDSVKDNLFEDDVYVFTPKGD
VIPLSPGATTIDFAYHIHTEVGNHCAGARVNGRMVPLSTRLSNGDIVEIITQKNSHPSLD
WLNFVRTSAAKYRIKQWYKRSRREENVARGRELLEKELGKTGLDSLLKSDAMRTVSEKCN
YHSAEDLLAGMGYGEVTLNLVLNRWREVVKSQQPVVDTPILLPKEPSTAKAPTPITRATD
SPIVGVEGLVYHLAGCCTPIPGEPIIGAVTRGRGISIHRQGCHNLETVECDRLVPVSWNP
VAENRGRPQTYPVNVQIEALDRVGVLKDILSRLSDQGINVRYAQVKTAVNQPALIDLGID
IRDRPQLEQVFIQIKKMSDILNIRRVGQIDE
Download sequence
Identical sequences A0A1W5CI08 Q3M350
gi|75911185|ref|YP_325481.1| 240292.Ava_4989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]