SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75911254|ref|YP_325550.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911254|ref|YP_325550.1|
Domain Number 1 Region: 10-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-108
Family Cystathionine synthase-like 0.00000000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75911254|ref|YP_325550.1|
Sequence length 381
Comment alanine-glyoxylate aminotransferase [Anabaena variabilis ATCC 29413]
Sequence
MTQIISINDNQRLQLEPLEVPSRLLLGPGPSNAHPAVLQAMNVSPVGHLDPAFLALMDEI
QSLLRYVWQTENPLTIAVSGTGTAAMEATIANAVEPGDVVLIGVAGYFGNRLVDMAGRYG
ADVRTISKPWGQVFSLEELRTALENNRPAILALVHAETSTGARQPLEGVGELCREFGTLL
LVDTVTSLGGVPIFLDGWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVANW
YLDMNLLGKYWGSERVYHHTAPINLYYALREALRLIAQEGLANCWQRHQKNVEYLWERLE
DIGLSLHVEKEYRLPTLTTVRIPDGVDGKAVARQLLNEHNIEVGGGLGELAGKVWRVGLM
GFNSRKESVDQLIPALEQVLR
Download sequence
Identical sequences A0A1W5CI41 Q3M2Y1
240292.Ava_5058 gi|75911254|ref|YP_325550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]