SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812660|ref|YP_320278.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812660|ref|YP_320278.1|
Domain Number 1 Region: 49-330
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-63
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 324-494,551-677
Classification Level Classification E-value
Superfamily TPR-like 1.42e-28
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|75812660|ref|YP_320278.1|
Domain Number - Region: 4-25
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.04
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812660|ref|YP_320278.1|
Sequence length 707
Comment TPR repeat-containing serine/threonin protein kinase [Anabaena variabilis ATCC 29413]
Sequence
MSIQCPTCLTDNTDDAINCIACGTPLVYTSNSSASSALDLAAGTLLGQGRYQIEKVLGRG
GFGITYQGIFLQNSAYIAIKELWPEGAARQKNTVLWPSSLPPIQKQQQLKKFQLEASYLH
QCIHPNIVRIYEWFEENNTAYLVMELLSGRSLQDILEKEGPLPEDKVKYYLLQIAESLKV
IHANRLLHRDIKPDNIIVDSQDRAVLIDFGAAREFMAGQTGDMTRILTPGYAPYEQYIQS
GKRYPATDFYALCASMYELLTGQLPAEATERANTLLQGSTSTPLIPPRQLRPNLSPLIEK
VILTGMQFRVEDRFQTADELIDALNGKFISPSHKRAQELVKQGKLAEAVLAYEKYLNSEP
NNGEAAVELAIIQLHLDETQAEIAAKKAMQLKPNDGRSYGVLGLVNCRKSNWSEALKNLE
QAANLAPQEVWIQANLAWALGKSGNWQQAENTVNKALQLDANCTFALGLQAWIAVNQEQW
KSGIRTASQAIFKSKQSSYTNSQELQRWVYPYLIFALDKAVVTKQASDVERRIQEFITQV
PDNSFGWGFKGWKAAVKCLWTDAISDFEQASRKSKVSSWILINQGIAQEYLHNFQAAIQA
YETHTQQFSPHAFVLFRLGTLYGRLGQWEKARSYLEKAVHEKSNYAEAYHNLGWVLLNIK
DQDGQVENFREILSSYRKAVELYTEQQKHPLAQGIKQVFQAVGVNNF
Download sequence
Identical sequences A0A1W5CPD7 Q3M1P7
gi|75812660|ref|YP_320278.1|NC_007411 240292.Ava_A0032 gi|75812660|ref|YP_320278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]