SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812663|ref|YP_320280.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812663|ref|YP_320280.1|
Domain Number 1 Region: 468-1037
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.67e-172
Family Acetyl-CoA synthetase-like 0.00000000931
Further Details:      
 
Domain Number 2 Region: 1560-2039,2453-2532
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.84e-152
Family Acetyl-CoA synthetase-like 0.0000000524
Further Details:      
 
Domain Number 3 Region: 2584-2864
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.17e-70
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.0011
Further Details:      
 
Domain Number 4 Region: 232-494
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.33e-62
Family NRPS condensation domain (amide synthase) 0.035
Further Details:      
 
Domain Number 5 Region: 47-225
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.17e-50
Family NRPS condensation domain (amide synthase) 0.0065
Further Details:      
 
Domain Number 6 Region: 1117-1322
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.45e-40
Family NRPS condensation domain (amide synthase) 0.015
Further Details:      
 
Domain Number 7 Region: 1310-1555
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.78e-33
Family NRPS condensation domain (amide synthase) 0.014
Further Details:      
 
Domain Number 8 Region: 2019-2219
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.94e-25
Family Arginine methyltransferase 0.058
Further Details:      
 
Domain Number 9 Region: 2513-2585
Classification Level Classification E-value
Superfamily ACP-like 1.01e-16
Family Peptidyl carrier domain 0.0017
Further Details:      
 
Domain Number 10 Region: 1018-1087
Classification Level Classification E-value
Superfamily ACP-like 3.4e-16
Family Peptidyl carrier domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75812663|ref|YP_320280.1|
Sequence length 2867
Comment amino acid adenylation [Anabaena variabilis ATCC 29413]
Sequence
MSNFSESLGDISPEQYELLQLLLKKRGIGKPEQKTIPKRIDQSPCQLSSAQQRLWFLHQL
NPDISVYNMPAAIGIQGSLNIAALAQTFNEIARRHEILRTRFETVNGKPIQIINPTISIP
LSVVNLQDLPDDKRQTEVTRLIKAEAEKPFDLTQTPLLRTTLLQLDVTEYVLLLTIHHII
ADGWSIDVLIREVMVLYEAFCSGQPSPLAELPIQYADFAFWQSQYLQGEVLANQLAFRRE
KLGHHPPALELPTDRPRPAIQTFRGATQSFSLSAEVTQALKTLSQTEGTTLFVTLLAAFK
TLLYRYTGQEDILLGSPIANRNRAETEGLIGFFVNTLVLRTDLSGNPSFRELIARVHEQA
SAAYAHQDIPFEQLAAELQPQRDLSRNPLIQVMFVLENRSRLLGELGDLKLSLLEINTAI
AKFDLTLILSETSQGLNGWLEYSTDLFDAVTITQMVRHFQTLVGGIAVNPDQRLASLPLL
SAAEQHQLLYEWNHPEISYPQHYCIHQLFEQSAQQAPEAIAVVFEEQQITYQALNQQANQ
LAHYLRSLGVKPGVKVGICVERSLWMIVGILAILKAGAAYVPLDPSYPQERLAFIIQDAQ
LEVLLTQQQLLEVLPPHQVQVISLDRDWQIIAQENQANPACTATVGNLAYIIYTSGSTGQ
PKGVLVPHQNVTRLFEAVQPWFEFNQQDVWTLFHSIAFDFSVWELWGALLHGGKLVIVPY
WLSRSPEAFYQLLCKQKVTVLNQTPSAFRQLIQAKEPFNHQLALRLVIFGGEALEISSLQ
PWCERHGDRYPQLVNMYGITETTVHVTYRPITMADLQVNSGSIIGRPIPDLQVYILDQHQ
QLVPIGVSGEMYIGGGGLAKGYLNRPDLTTEKFIPHPFSNQPDARLYKSGDLARYLPNGD
IEYLGRIDHQVKIRGFRIELGEIAGILTQHPSVQETVVLAKETSSGEKYLVAYVVFRHQQ
TPTTSQLRNFLKKQLPDYMLPSVFVVVEALPLTANGKLDHQALPEPSTSRPELDTAFVSP
RTATEKILTEIWSQVLGFAEIGIYDNFFALGGDSIRSIQVRSLAQERGLYFSLQQIFQHQ
TIHELIADVVIAENPQATTQSIAAFSLISEQERSQLPENIEDAYPLTMLQMGMLFHNEYD
TDTPIYHNVASLHIQAPFAPQHFQTAAQQLINRHPVLRTSFDLSNFSQPLQLVHKNVAVA
LQVEDLSHLSTIEQEEILNAELEAQKRHKFDWTSPPLLRFHIYRRSSQTFQFNFSEHHAI
LDGWSVATMLTELFENYFSLLQGETPTIKLSPEIAFRDFVALQQTALQSQASQDYWKQKL
KGCMMTRIPREYQPQSATTSAIRAFPVLISDETATGLQQLAKVAKVSLKSVLVAAHIYVL
SQLSGQSDVVTIMASHGRPETTDSDWSLGLFLTPLPLRMKLSGGTWIDLVQQTFAAEKDL
LPHRLYPLAQMQIDLGNQRLAETSVNFTRFHVYERLQQLSGLQIIDTQGFAMTDFALVAE
FSFDVFASQLQLFLMCNTFEFSEQQIEKIGENYAQTLAVMAKETTANYQLVEVANQTVKE
DEKYQLLAISTGEKINYPQYNCIHQLFAQQVARIPDSLAVASEHQQLTYLQLNNSANQLA
NFLQNLGVVTETLVGICVERNPQMLVGILGILKACGAYVPLDPSYPQQRLDFMLQDAKIE
ILLTQKHLLPKFSHHNIKIICIDTEWEAIAQHSDAHPECEITSDNLAYIIYTSGSTGLPK
GVEITHKNLIHSTIARINYYPEYDVNFLLLSSFAFDSSVAGIFWTLCCGGTLYLPQVGEE
KEVRKLVKLISQYQISHLLSLPSLYALILEQAEIAQLTSLHTVIVAGEPCPKKLVQSHCE
LLKTTSLYNEYGPTEATVWSSVYNCSWPEAGISIPIGRPIHNTQIYILNSDGKLVPVGVT
GELYIGGDGIARGYLGKPQLTAEKFIPDFFSDEPGARLYKTGDLARYRPDGNIEFLGRSD
RQVKIRGFRIELGEIEAVLEQHPTIREVAVVSREIQGDLRLVAYIVPSPQQLYFQATTLE
QQYIANYQTVYDEIYSQDQNFSQLDSTISLRAWISSDTNQPLPEAEVIEYADSTAQRILS
VMQPKRVLEIGCGTGVILLRVAPHCTHYCGTDISDVALRYTQQQLAIRQPDILTKVSFLH
RAAHNFQDIATEQFDTIILNEVVQHFPSIEYFVDVLQSAVKVVQPGGCIFLGGVRSLPLL
EAFHTWVQLNRVPPSWSTAQFYQQVQEQLSAEKELVINPDFFTALQKYLPEISYVQICPK
RGSYHNELTKFHYDVILHIKAEVNLTPDILWLNWHEEKLTVTAVRQLLKSSAPATLGLRN
IPNARVETSAKAVELLRQNSGIQTVAELKQALQSNFSPLGVDPEEFWTLSQDLPYTVDIS
WANAAIDGSYDVLFRRYSDNSTNLIPGFGAIATNSQQPLDTYTNKPLHSQSKLTSELIPQ
ITSYLREKLPEYMIPVNFVALEALPLTPNGKVDYQALPAPQQIRSRFTETLIFPRDSLEL
QLAQIWEDILDIHPVGVTENFFDLGGHSLSAVRLMAQIRTKLNQELPLSILFQGITIEKL
ASILRQQSDVQTHNLLIPLQPHGSKRPFFCLHPAGGNVLCYYELARHLQPDQPIYGLQAL
GLDGEQQPYNRIEDMAAHYIQLIRTIQPTGSYLLGGWSMGGAIAFEIAQQLHQQGDRVDL
LALFDSLAPIPQNKPTNISEYNDAKMLSQLAQDMASLTGRNLAISEQQLQQLKPDEQLQY
FLEQAKIANIFPPDIEYQQLSNLLQVFKSNIQAILNYAPQVYPQRIVLFRASENNFNQAP
QNQTLGWDELSSESVEIVNVPGTHYTMLTKPHVQTLLEQLRHYLAQD
Download sequence
Identical sequences Q3M1N0
gi|75812663|ref|YP_320280.1|NC_007412 240292.Ava_C0002 gi|75812663|ref|YP_320280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]