SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907858|ref|YP_322154.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907858|ref|YP_322154.1|
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.31e-18
Family Collagen-binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 694-797
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000876
Family Collagen-binding domain 0.0073
Further Details:      
 
Domain Number 3 Region: 234-338
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000157
Family Collagen-binding domain 0.0087
Further Details:      
 
Domain Number 4 Region: 348-451
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000458
Family Collagen-binding domain 0.013
Further Details:      
 
Domain Number 5 Region: 464-574
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000641
Family Collagen-binding domain 0.0083
Further Details:      
 
Domain Number 6 Region: 118-226
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000157
Family Collagen-binding domain 0.008
Further Details:      
 
Domain Number 7 Region: 583-684
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000785
Family Collagen-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75907858|ref|YP_322154.1|
Sequence length 800
Comment peptidase [Anabaena variabilis ATCC 29413]
Sequence
MAEPNNTLAQATNLGRILNSQTISDFVGTTDTNDFFTFNLGSRSSFNLTLNGLSADADVQ
LLDSTGGLITSSSNGGSLSESITQTLNTGNYAIRVFQFSGNTSYNLNLSASPFDFAGNST
AAARDIGPVGVQSFFQDAVTSSDTTDFYRLAINPNSSLSITLDNLAADADLSLLNASGTV
IRSSSNGGTTADSISLSASEVRANGTTYFVRVNQFSGNTAYNLTINGSLPDLAGNSTATA
RDLGNLNGTQEFIDLVNSADTNDFYRFTVGPNSNLTARLDNLAANANLQILNATGTVIGS
SSAGGTAADQVTLNNLAGGLYFARVLQSSGDTSYRLNLFATQPDFAGNTTGTALNFGTLN
GTRVFNDEVRPGDINDFYRFDLTGGSTVNLTLNGLTADADLRLLNSVGTVIASSLGLGTI
AESINTFLLAGTYFAQVSSFNNASTLYNLSLSSNLVPTVDLAGNTPGTARNIGPVGVQSF
FRDRVSSTDSNDYYRFTINPNSGLNIVLNGLSADADLQLLRADGTTLVRSSSNSGTTEDT
ITLTAAEVRANGTEYVVRVNSFNGANTAYNLSINGSLPDVAGNSTGAARNLGNLNGRQEF
IDFVNGADTNDFYQFTVGPNSNLTARLDNLAADADIEILNSAGTVIGSSRLSGNAADQVT
LNNLAGGLYFARILRFGDTSYRLNLSATQPDFAGNTLATALNFGELNGSRTFNDDVTSTD
LRDLYRFTIGNTSTLSVNLSGLTADADISLLDSAGTFIVGSSNAGTSPDFFTRSLTPGTY
YVSVDRFSGDTLYNLRLVAA
Download sequence
Identical sequences Q3MCM7
gi|75907858|ref|YP_322154.1| 240292.Ava_1636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]