SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910190|ref|YP_324486.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910190|ref|YP_324486.1|
Domain Number 1 Region: 33-411
Classification Level Classification E-value
Superfamily Thiolase-like 1.51e-105
Family Thiolase-related 0.0014
Further Details:      
 
Domain Number 2 Region: 572-694,756-870
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.89e-83
Family FabD-like 0.00011
Further Details:      
 
Domain Number 3 Region: 1234-1455
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.56e-48
Family Tyrosine-dependent oxidoreductases 0.0065
Further Details:      
 
Domain Number 4 Region: 1471-1706
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.41e-47
Family Tyrosine-dependent oxidoreductases 0.0000264
Further Details:      
 
Domain Number 5 Region: 1748-1828
Classification Level Classification E-value
Superfamily ACP-like 1.28e-16
Family Acyl-carrier protein (ACP) 0.065
Further Details:      
 
Domain Number 6 Region: 699-763
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000183
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910190|ref|YP_324486.1|
Sequence length 1874
Comment short-chain dehydrogenase/reductase SDR [Anabaena variabilis ATCC 29413]
Sequence
MSPNSENTNYRLLLENAILELRRMRSEVDTVEQLQKEPIAIIGMSCRLPGGVNNPEDYWN
LLHNGVDAISKIPAQRWPVDEFYHPDPEVSGKMYTQHGGFLNEVDKFDAQFFGISPREAV
SLDPQQRLLLEVSWEALENAGQAPEKLNGSPTGVFVGLSMDDYSQLSFYGDRTQIDAYNT
LSILRSMAAGRLAYVLGLQGATMQLDTACSSSLLGVHLACQSLRSQECNMALAGGVNLIL
SPDPSIGLCKLKALSTDGRCKTFDASADGYGRGEGCGIVLLKRLSDALADGDPILALIRG
SAYNHDGSSNGLTAPNGSAQEKLLRKALENANVQAHQIQYVETHGTGTPLGDPIEVLALG
AVLGEGRSEDNPLTIGSVKTQVGHLESAAGVAGLMKVVLALQHAQIPPHLHFQQPNPYIP
WEKLPVVVATQPTQWPLGADGRRLAGVSSFGMSGTNVHLILEAAPLESQKLKVKSQKEEA
IERPLHLLSLSAKTESALQSLVSRYESFLKDDSKANLADICFSANTGRSHFDHRFAVVAE
STQDLRQQLAAFTAGKTPGVSGQLHNKKRPKIAFLFTGQGSQYIGMGRELYETQPTFRQT
LDRCDEILRPYLEQPLLSVLYPESGTSPLNETAYTQPALFALEYAVCQLWKSWGIEPTVV
IGHSLGEYVAACIAGVFSLEDGLKLVAARARLMQSLPQDGAMVNIFASQGRVLAAIQPYA
DQVSIAAINGPESVVISGQHQAVAAVMSTLQSEGVNSVKLNVSHAFHSPLMEPVLAEFAR
IASEVSFSSPNIKLISNVTGTVVTTEITNAEYWVRHLRHSVRFAAGMETLEQQGCDIFLE
VGPKPVLLGMGRKCLPEGVGIWLPSLRPQQSDWQQLLQSLQELYLRGASINWSGFDQDYP
RHRLVLPNYPFQRQRYWVETSHRQQTLPAKTSKTLHPVLGQRLKLPFSPEIRFETQFSPN
SHAYLEDHQLNGVRIVPGASYISMLLSAVREAFPNESCIIEDLLFQNTLVCPDDGSTTVQ
LVLTPQTTEETSWQIISFLGGEAENEVNAWKTHSTGKVRLFSPVPNFVDVAQVKARCSQV
LSGTQFYSNFQAVGYSWGTSFQWLENIWYQDGEAVCQMKLPQLPDELDNYQLYPGLIDSC
LQLLNVCWDINPAEQVQNDYMYIPFSIGSLRFYGRPHPGHQLWCHGQKTPTSNQQSLTGD
VHLFDQNGQLIAEIIGFEVRKVRRATLLQSLQKDLGDWLYEVAWQPKPREQNHQLAQTQE
LGSWLIFADEQGTAVKLAKLLQERGDRPILVSPGAEYQANGEHYYINPSEPQDFQRLIQE
SLGNHQPPCRGVVYLWGLEEARETLNTGCGNVLHLVQALAQSTWSKPPRLWLVTRGTQPV
EPMSDSLAINQAALWGLGRVISLEHPELSCVRLDLDPVGNGNEIEELLAELLFPDQEDEV
AFRQGVRKVSRLVRRQAQTPTNQLAIGEDVTYLITGGLGALGLQVAQWMVAQGAKNLVLT
GRRGVVGDTQVAINQLQQAGAKVLVVTADVSNPEDVAQMLEAIKTNYPPLRGIFHAAGVL
DDGVLLQQNWSRFAKVLAPKVQGAWNLHTLTKDLPLDFFVCFSSVASLLGSPSQGNYAAA
NAFMDALVHYRRGLGLPGLSINWGPWAEVGMAADLDSRSQKRIAESGFATISSELGLQLL
GDLLRQDATQVGVMSVNWEKFLQQFPPGGAAPLIADLAPQTQPQSNSAQSGKQLELLRQL
EENIASDRQNVLIAYIQTEVAQVLRFEASYQPNPQQGFFDMGMDSLMSIELKNRLETSLG
NSLPSTLTFEYPTIESLAEYLLNNIISLTVAEPVVVEPQIEAEEQTDLLIDIQQYSEDEL
AALVDQELEALLGV
Download sequence
Identical sequences Q3M5Z5
gi|75910190|ref|YP_324486.1| 240292.Ava_3986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]