SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75911034|ref|YP_325330.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911034|ref|YP_325330.1|
Domain Number 1 Region: 506-1076
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.83e-134
Family Acetyl-CoA synthetase-like 0.0000000221
Further Details:      
 
Domain Number 2 Region: 1129-1393
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.19e-59
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.0011
Further Details:      
 
Domain Number 3 Region: 263-534
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.56e-57
Family CAT-like 0.036
Further Details:      
 
Domain Number 4 Region: 78-255
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 9.23e-50
Family NRPS condensation domain (amide synthase) 0.0022
Further Details:      
 
Domain Number 5 Region: 1057-1129
Classification Level Classification E-value
Superfamily ACP-like 2.49e-18
Family Peptidyl carrier domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75911034|ref|YP_325330.1|
Sequence length 1436
Comment amino acid adenylation protein [Anabaena variabilis ATCC 29413]
Sequence
MKTLDELLSELRQRNVQLWLEGDRLRYRVAKDSLTPELLTELKSQKAEIIDFLRRITTVA
SSQIPPIVSCERNGSLPLSFGQQRLWFLHQFEPDSSSNNMPVVVRFTGNLNVTILEESIN
EVVRRHEVLRTTFPAVNGKATLLIAPDISLQLPIIDLQSVSDEEREAEAYRLATNEAHRP
FDLANGPILRVLLLRLSEQEHLLIWNMHCIVCDGASSDVFYQDLTTIYKALAEGKASPLS
PLPLQYADFAHWQHQWLQGEVLESQVNYWKQKLEGSLPIIQLPYDRPRPAGAQTYRGDRS
ALLLPKSLNYALTELSQKWGVTLFMTLLTVFELLLYRYSGQEDLLISFASAGRGQVETER
LIGFFSNTLVLRSNLAGNPTFRQLLGRVRKDCLEAYAHQDLPFERLIEELRPEQRNRSTS
PLFQVKFSLNPPWSNGRGMASVELPDLKITSLFGYIYHGKTKYDLTLVLREQDNGLGMVF
DYNADMFESSTIERMLGHFQNLLEGIVANPDCPISELTLLTQPEQHQLLVEWNHRQTADI
KDICIHQLFEAQVRRTPHNIAVIEDNQQLNYQELNERANQLAHYLQTLGVGAGICVGLYL
EPSLEMIVGLLGICKAGGTYIPITPTSHPNDLAFILNDAHVSLLLTKKSWSEKLPECESS
IICLDSDEEVIAPHSRQNLVTQVTSGNLACVIYAPNPINKPDGIAMSHSNLVNHAVAIHQ
LWEVSAGDRILVFSGISSDTTIESLFPCWMNGASAVIQPQTTQNSITNFFSFIAQQQITV
LNLPTFFWYKILKEISTSQAPLLESLRLVMVGGEKVSRTAYESWIELVGKQTRWLNAYGS
IATTFTATVYDPQTASSETEILIGQPIANTQIYILDQLLQPVPVGAPGEVYISGVGVAKG
YFRRTDLTSERFIPHPFSDNTHERLYKTGDLARYLPDGNIEYLGRTDNQVKICGVCVDLE
QIEALLHQHQAITQAVVIATEVTSGEKQLVAYLVTQPEQTPTIDDLQTFLSQKIPHYWIP
SDFIFLESLPVNTNGQVNRGALPEPNFIKQKSGANFVAPRNQLEIELTKIWENVLGKHPI
GLKDNFFGLGGHSLLALRMFSQIETIFGKNLPLAILFQAPTIQQLSDILQQEGCSTSWSS
LVPIQLNGSKPPLFLIHPIGGNVLEYSTLTHYLGEEQPIYGLQSLGLDGKQAPLNRVEDM
ANAYLQEIRSIQPNGPYFIAGYSFGGLVAYEMAQQLYTQGQKIGLLALLDTSCPNLQITR
PSLNKFVRVHVNNLWKLQPQEKLIYIRNWLKWYLKKKNTRDVLIQDWQEVLENSHIVNVI
DANVQAYENYTAQPYAGAMTLFRSSIQPVKLSDNIDLGWHDLVTGGLEIHHLTGDHSRLL
KEPHVQKLTKQLKICLERSLTDNTLLFDDLNKFQPRLISHVGTTQTSSQFSINVSK
Download sequence
Identical sequences Q3M3K1
240292.Ava_4838 gi|75911034|ref|YP_325330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]