SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75911119|ref|YP_325415.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911119|ref|YP_325415.1|
Domain Number 1 Region: 13-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-56
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 398-515
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.63e-30
Family Pentapeptide repeats 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75911119|ref|YP_325415.1|
Sequence length 524
Comment serine/threonine protein kinase [Anabaena variabilis ATCC 29413]
Sequence
MSYCINPTCPNPENVAYSQRCEACGSRLLLRDRYRVLKPLGQGGFGATFLAHDQILPGEP
SCVIKQLRPSGTAPHVLQMARELFEREAKTLGTIGNHPQVPRLLDYFEEQEQFYLVQEYI
SGSTLQQEVKLNGTLSEAGVKQFLSEILPLLQYIHEHKVIHRDIKPANLIRRSQDARMVL
IDFGAVKNQVSQAITNQSANTALTAYAIGTPGFAPPEQMAMRPVYASDIYALGVTCVYLL
TGKTPKDLDYNPTTGEVMWEHLVQVSDHLIGVLRKMLEVSVRSRYQSATDVLKALEIEPY
LESLAQGLLVKSEKEQTSQRPENSAVLSSSSPVAATSVGGVAQVAAAIRARRAKDAAAKL
AILPNSNSNGNGLPTQQSKAGRRLDSQTLIKAYLKGRRDFALHNLNFLNLQGVDLSETNF
HSAQLQSTNLQGANLHNSDFGRASLTRANLKDANLSKAYFNHADLEGADLRGADLSHAYL
SNANLRGTNLCGANLTGAKITDEQLALAKTNWMTIRPNGKRGLL
Download sequence
Identical sequences A0A1W5CHY7 Q3M3B6
gi|75911119|ref|YP_325415.1| 240292.Ava_4923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]