SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37676044|ref|NP_936440.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37676044|ref|NP_936440.1|
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily beta-Roll 9.59e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37676044|ref|NP_936440.1|
Sequence length 190
Comment calcium-binding protein [Vibrio vulnificus YJ016]
Sequence
MAVYSGTADVDVLSNYTGSDDKFVGHGDNDNIIGGGGNDLIIGGAGDDRLVGGRGDDILK
AGLGDDYLGGGSGDDLLLGLYGNNHMNGGLDNDVLVAGSGDNVLIGGQGADKFIFTDKFD
GHGTAKVVDFTIGEDTVRIDSATIHSLDDLSVSYDAVGNLVLSDGGAFTVKLIGVTEADF
VAHADDMFQF
Download sequence
Identical sequences A0A0H0XUR0 A0A2J9VP01 Q7MFD6
WP_011151776.1.34622 WP_011151776.1.54486 WP_011151776.1.63462 WP_011151776.1.79678 WP_011151776.1.99976 gi|37676044|ref|NP_936440.1| 196600.VVA0384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]