SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDAG_09063T0 from Verticillium dahliae VdLs.17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDAG_09063T0
Domain Number 1 Region: 23-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-90
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000494
Further Details:      
 
Domain Number 2 Region: 368-533
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.32e-50
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000692
Further Details:      
 
Domain Number 3 Region: 278-359
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000000196
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDAG_09063T0
Sequence length 535
Comment | VDAG_09063 | Verticillium dahliae VdLs.17 rhamnogalacturonase B (536 aa)
Sequence
MAPSLVQLSLLTAVSFTSSALAAFGYTTSGNNYVVDTGSSNTLVFSVSRSSCDINSIKYR
GNELQYASQGTHISSGLGTATVTATQTSGVITITCSTSTLTHYLVAKEGDSLIYMATHIT
AQPEIGELRYIARLKNDVLPLEYPYGTASTTGGSNSTVEGSDVFVVNGQTRSKFYSSDRY
IDRGVHCVHGTSPEEIHACMIIPQTETSSGGPFHRDIETNNNGPFTALYNYMNSGHVQTE
EYRMGLHGPYALSFSRSDIPSTGDVDFTFMSSLGLRDYVAAGGRGRVSGRATGVPSSFRP
VVHWYNKDAQYWTTAGSNGTFTSPAMKPGTYTQVLYQTEYKAAETSVTVTVGSTTTRDIA
STIQAPSNSLFKIGEFDGQPTGFRNADKFLRMHPSDSRMSSWTNSYNVGSSELSDFPMAI
FKSVNNGVVINFNLASAPGAATFRISTTLSFAGARPVVQVNTWTAATPVAPRNLNSRGVT
RGAYRGLGEQYDIAIPSGQLKAGANTITISVASGSSGDTFLSPNFIVDALELFTS
Download sequence
Identical sequences A0A2J8ERN4 G2XFD9
XP_009653660.1.79873 VDAG_09063T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]