SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDAG_10443T0 from Verticillium dahliae VdLs.17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDAG_10443T0
Domain Number 1 Region: 12-327
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-66
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 436-652
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-18
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.071
Further Details:      
 
Domain Number 3 Region: 337-423
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000392
Family Rhamnogalacturonase B, RhgB, middle domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDAG_10443T0
Sequence length 654
Comment | VDAG_10443 | Verticillium dahliae VdLs.17 rhamnogalacturonan lyase (655 aa)
Sequence
MAGMAQMVAAVLQTTETSNSYIIANDRLNATVTKTGGIIVDLTLDGQDLLGPATGSIGRG
PYLDCYCTPAGFWTPGRDRPTLALYSGEDATGTKYGGFKMSDTFPATGQVLEQYIFLREG
ETGLHMFSRVAYHNETTPFLRNLQELRTLFRPNTEMWTHLLTNPEQYGPLPSKDGVAKQV
VVQDATWDLSATPNDPYVKEFSEYFTKYTFQSTWENHKAHGMFADGSKTADGSTFGAWMV
MNTRDTLFGGPLFSDLTVDGIVYNYISSNHHGNQTPNITSGFDRTFGPYYYHFNKGPAGT
DIKELHADAAQYADPEWNSEFYDAIAPLVPNYVTTKGRTTWKLHVDLPKGAKKPIAVLSQ
NGVYFQDNVFDTKAYQYWTEVSESGDATIPMVKAGTYRLTIYAEGIFGQYIKDDVKIEVG
GRIRTTHARWREENAGTEIFRIGTPDRSSGEYRHGFEKDLSKPRQPAEHLIYWAAYDFPS
EFPDGVRYKVGESDPAKDLNYVHWSVFGGRGNSVRKDMYLGDGNVNNWTIVFDLEEAQVR
RKREATFTVQLAGAKTAAGNTDVFNASEPHANLAYTVNVNGQDLKPWVIPSSCAVRSAVV
CYQVGNKFSFHPSMLKAGENEIVLSLPYGATNYEPALLTQALYVQYDALRLEIR
Download sequence
Identical sequences G2XJW1
VDAG_10443T0 XP_009658000.1.79873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]