SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDAG_00498T0 from Verticillium dahliae VdLs.17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDAG_00498T0
Domain Number 1 Region: 42-275
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.35e-66
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00016
Further Details:      
 
Domain Number 2 Region: 249-524
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.46e-64
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) VDAG_00498T0
Sequence length 527
Comment | VDAG_00498 | Verticillium dahliae VdLs.17 tyrosyl-DNA phosphodiesterase (528 aa)
Sequence
MERPSKRLRVTEDVTDDPPAQPSSLHRAISPPARKKSKATTTPSPFQLTHIRDLPDSSNA
DTVTLKDLLGDPLISECWEFNFLHDIPFLMSHFDKDTRDLVKVHVVHGFWKREDGNRMAL
QEEAAAWKNLELHNAPMPEMFGTHHTKMMILFRFDDTAQVIIHTANMIAKDWTNMTNGVW
RSPLLPLGPQPDSGKPEAEEESEADEDFGSGRKFKSDLLSYLRAYDARKITLRPLTEQLV
KYDFAGIRAVFIASVPGRHAIHDTSQTAWGWPALKRALRRVPVQAGKSEVVVQISSIATL
GGTDSWLQKCLFDSLSLSKGSSISPRPAFRVVFPTADEIRRSLDGYASGGSIHTKIASPQ
QAKQLAYLKPIFCHWANDAPGGKEISKDTALQDAGRQRAAPHIKTYIRYGTQSIDWALLT
SANLSKQAWGEAASAAQEVRIASWEAGVLVWPSLVAGTDEAIMVGTFKTDAPGEEAPSGA
PSSTGNVVGLRMPYSLPLQLYGKDEIPWVASNEHTEPDWAGRVCLRQ
Download sequence
Identical sequences A0A2J8EVQ7 G2WQ56
XP_009650170.1.79873 VDAG_00498T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]