SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_06867T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_06867T0
Domain Number 1 Region: 132-250
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000862
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_06867T0
Sequence length 371
Comment | VDBG_06867 | Verticillium albo-atrum VaMs.102 conserved hypothetical protein (372 aa)
Sequence
MSSRFAAGGEGFWTAASRSISSSSSSTSTPSSTTSTARHDAYGRRLSVEEDLFYQQLMTA
DPRPPSEPPPPYRPQALRPASSLITVTDDRRQQPQQRQALIELPPKYHTDIDLAAVWELK
MELEDAVDRADDRTWHTVIVQLRGTSLKLYSVKKEWTQWGWGAAREWASSNQSPDNPPWA
RRATLLRTYHLQHADIGIAADYKKRRNVIRLRLETDQLLLSCLESATFVRWLDAFFAAIA
IAAPLDEREYPADQSVPRSQRTRWLQAQRRGLTLAPRAYSPSITSSLSLSSHLDMDADPY
PSPEMSDGTQGMAGQGMIQGQVPSGGSTPALSRRSTTGSASFRRLVAAAGGGEVDGKWAP
PRETWDPPEEE
Download sequence
Identical sequences C9SPP2
XP_003003305.1.67963 VDBG_06867T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]