SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_08248T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_08248T0
Domain Number 1 Region: 12-316
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.79e-60
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 425-641
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-18
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.071
Further Details:      
 
Domain Number 3 Region: 326-413
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000216
Family Rhamnogalacturonase B, RhgB, middle domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_08248T0
Sequence length 643
Comment | VDBG_08248 | Verticillium albo-atrum VaMs.102 rhamnogalacturonate lyase (644 aa)
Sequence
MAGMAQMVAAVLQTTETSNSYIIANDRLNATVTKTGDLLGPATGSIGRGPYLDCYCTPAG
FWTPGRDRPTLALYSGEDATGTKYGGFKMSDTFPATGQVLEQYIFLREGETGLHMFSRVA
YHNETTPFLRNLQELRTLFRPNTEMWTHLLTNPEQYGPLPSKEGVAKQVVVQDATWDLSA
TPNDPYVKDFSEYFTKYTFQSTWENHKAHGMFADGSKTADGSTFGAWMVMNTRDTLFGGP
LFSDLTVDGIVYNYISSNHHGNQTPNITSGFDRTFGPYYYHFNKGPAGTDIKELHADAAQ
YADPEWNSEFYDAIAPLVPNYVTTKGRTTWKLHVDLPKGAKKPIAVLSQNGVYFQDNVFD
TKAYQYWTEVSESGDATIPMVKAGTYRLTIYAEGIFGQYIKDDVKVEVGGRIRTTHARWR
EENAGTEIFRIGTPDRSSGEYRHGFEKDLSKPRQPAEHLIYWAAYDFPSEFPDGVRYKVG
ESDPAKDLNYVHWSVFGGRGNSVRKDMYLGDGNVNNWTIVFDLEEAQVRRKREATFTVQL
AGAKTAAGNTDVFNASEPHANLAYTVNVNGQDLKPWVIPSSCAVRSAVVCYQVGNKFSFH
PSMLKAGENEIVLSLPYGATNYEPAILTQALYVQYDALRLEIR
Download sequence
Identical sequences C9SUM8
XP_003001203.1.67963 VDBG_08248T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]