SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_00540T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_00540T0
Domain Number 1 Region: 7-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-121
Family Motor proteins 0.00000000203
Further Details:      
 
Domain Number 2 Region: 501-608
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.48e-22
Family FHA domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1560-1626,1678-1714
Classification Level Classification E-value
Superfamily PH domain-like 0.000000019
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Weak hits

Sequence:  VDBG_00540T0
Domain Number - Region: 814-943,1564-1583
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0136
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_00540T0
Sequence length 1737
Comment | VDBG_00540 | Verticillium albo-atrum VaMs.102 kinesin heavy chain (1738 aa)
Sequence
MPPAGGGNIKVVVRVRPFNGRGEHRTPELPSDAANALAKVDRGSKCIVEMRDNQTVLSSP
HTSGKDAGPKVFAFDKSYWSFEKKDKHYAGQDSLFDDLGQPLLDNAFQGYNNCIFAYGQT
GSGKSYSMMGYGKEIGIIPNICQDMFRRISQLQEDKTLKCTVEVSYLEIYNERVRDLLNP
ANKGNLKVREHPSTGPYVEDLAKLVVGSFQEIEHLMDEGNKARTVAATNMNETSSRSHAV
FTLMLTQKKLDVETKMEMEKVAKISLVDLAGSERATSTGATGARLKEGAEINRSLSSLGR
VISALADLSTGKKKKGTGSSVPYRDSVLTWLLKDSLGGNSMTAMIAAISPADINYDETLS
TLRYADSAKRIKNHAVVNEDANARMIRELKEELALLRGQLGGGSSGTAAVGSSVTAEEVY
PEGTPLEKQFVSITSSDGAVKKVSKAEIAEQLNQSEKLLTDLNQTWEQKLAKTEEVHKER
EAALEELGISIEKGFIGLSTPKKMPHLVNLSDDPLLAECLVYNLKPGTTTVGNMDTNADN
QANIRLNGTRILHDHCAFDNAADGTVTVVPREGASVMVNGKRIDEPKKLHSGYRVILGDF
HIFRFNNPMETKAERADKSLLRQSVATSTLQNLDRTSPTPTASPRPGHTRNISMAGSDFG
DSRPESPLPFSRNGRDSDWSFARREAAEAILGTNQNLTTLTDEELNTLFEDVQKARAERV
NVRDGDEDSESVTSYPIREKYLSAGTIDNFSLDTALTMPSTPKQGAVDDQLREAREEMQS
QLEKQREEYQDQLKTAEASNVEVEEIKKEKVRMEETLKTLKADMQKQLEVQRRQFEDKLE
KMDPLKRKKASPKLSEEELKLAAEVIHHWKSKRHVRMAEAVLQHASTLKEAQIMSNELDE
HVVFQFTVVDVGHSLCSSYDMVLNGLTGEGDDIALEQAPKPCIGVRVIDYKNSVVHLWSV
EKLHDRVRQMRQMHQYLDQPEYAQHLSLDNPFVENCMPQYTLVGEVDVPLRAVFESRVQD
FALDVLSPHTSHAIGIIRLSLEPSHARAPTNTLKFNVVMHEMVGFAEREGTEVHAQLFIP
GVSEEDGVTTTQMIKDFDEGPIRFESVHSMTIPLFSPPTITLRAAVFAKVSAMHLDKLLS
WDDMRDAVPVAQGKPKGARIAESQFYTEEKHDLLARIQLLELNEEGQYVPVEVIQTSEMD
GGTFQLHQGLQRRITINLTHSSGDALPWDDANSVRVGKIQLLDQAGKSPDMGTPSPDITL
KLASKPVFRNNANGTRDITLTGQWDSSLHNSLLLDRVTAEKYRVQMTVAWEIKSEKFVEP
MRFSLNVCCQIMSRSYVRQTSILSSLWQSIRIVHSATGIFTLSVRPAPIKRAGDLWRMNS
QHDYVKGEEQLTTWTPRGVSLVSDYIIARKKRRRITEIGAVQLLLNQIGLPEPREQAADN
VSLVDSIPDELIRPNDDDLLNDTPESSQIPVDDDEDIEDDVQEVDGTDTPAPVEPAEDDS
GFSDQEKTLLERCVKLWTRYPDPLLRILSPTNTDPPANGVTSESAAPRTLVTTIIKVPKN
PKVLKGGYLLVPNSNSTRWVKRFVELRRPYLHIHSAADGDEVGIVSLRNSRIDSQPGVVG
LLQGSPNGQEDAHGSGEDFRPSHRRTSSGRIISTIWTGSGGGGSSGGMQRLSERLQAGVF
AIYATDNTWLFAARSERDKMDWIFRIDQSYVSSNGSANDSGTTSPAGGSYNDGAGDY
Download sequence
Identical sequences C9S6C0
VDBG_00540T0 XP_003008858.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]