SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_01978T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_01978T0
Domain Number 1 Region: 1256-1386
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000357
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_01978T0
Sequence length 1586
Comment | VDBG_01978 | Verticillium albo-atrum VaMs.102 anucleate primary sterigmata protein A (1587 aa)
Sequence
MEEAGKLGTALVQQRKELAQRLKEVEKLQAEGDLTDELRTKLAEIEKEYNDVARETARAF
LPKQRVPSNEAAGGSPYVPEGRGGRRSVSPSKFESQATGSPTKLSVPNRKIRNQPSNRVH
DIEFAAEISTSLLAQVRNLQALLAEKDEELRDTKAEKSRLEIETEGFQQRVKTLDESEHR
YKDENWNLETQIHELMASQKEGTDREKKMTQALNILQAEKNQAQKELDEVKLSHAKLAEE
HEASIKHHDIELGTAKRSAALAETERTTLQRKIDDLMGQNQELAKAFSSQRGRGLERDHH
MGMSDEDFETANDNVTPEHSPPPSPIKGTPRHSVLESETLKTSLLHAQRTIQSQRSQLHR
EKTEKLELKRLLQDSRDELERSRNDSGGLTNRRSRKVDSKEFKKPAKTLLGGLRSSRSEI
VDDPEWEEHSEGVSPRRSSTHSTPTSRMPGPGAYPMTTDTSDQFDTANETSDAAFETANE
RGTETEGFHTGAEEFSDDDDAQTETESPSRSRRPPALTLAGNRNSFHSTASTSADEDMDY
SDLRTPVAHSSQQKMRLKVSRGFLNRRSRQASEEPTFQSSPASFATSSANGTPQQAGQSL
FAELAELEGSDAESLDATPSRRARSITPASVAKSSSTTPSVLALPQLAMVDSGIMTDPVK
KSREPSPDLTRTRPVMVDCGVMTEPMEPLTPRSPASVVALDRPTSVSSTLDAGTNSGQSD
TTASRLPDSPRSRPQSTWSYSDAGAQHDPGMDRELSQFPLPPTMQHGFALPSAPSLSFSA
IDNQDIVPVPEPVVLPPAPAALTLTALDSTAIEPKAEPEPVPEPAPALRLSPILSETVEP
KVEPEVAVPVPILKYSPLMSSTVEPRAEPEVILPAPVLGLSSHWSEAVEPRSEPAMVPPP
PPPAPELAFSALVSEIVEPRPELEMAPPPPPPYAATHTLSPRFAFSTIDSVETRPLTPRT
PKRDGFILPRGMESPFVNADQLRTPDDALFGGIAGRGQSGGDAGPVIAEDETRQSPSESR
HPDTPESQKPFKEISSNVESRPARKPAVSMSDQSAQTSLTADAIDDMFNARSKSHNKSLS
MGSSFGTPGTVRIRRYSQDQASLSSVRRMSVESQRDTTAAPQRPGSASSRRNSNVQPMPP
LPQNHMEVIEAARSGSAHGTPGTASVMGPPLWPASAMRGQRPQTPSSVRPQSPVSVKGTP
TPKAIRTGTAAHGTAIIHSPTKASARSRRSSVSSFASEIDTRFNIRANGLGVDATGFGPN
TDPRMIQAITQTMIGEYLWKYTRKAGRGQMSENRHRRYFWVHPYTRTLYWSDRDPSTAGR
ADMKAKSVSIEAVRVVTDDNPMPPGLHRKSLIVVSPGRQIKFTCTTGSRHETWFNALSYL
LLRTNDEGQTDAEEMAGHITQADVDEFNPQVGGMRPTASAAPSIRPRMAPSLSSYNSRTT
RNQSPAIDMSMEVPRLTPTHQKNATPQRPSIGTLGRLSGYWKNSQVISGTFSSLRSRTAS
GQYGNSIYEASEVHDSAEDVREMIERQDREADRLENVRACCDGRHDVGTLHHHSTLKRSR
GSHAHSQTGPSTTPSATPMSTTKSRT
Download sequence
Identical sequences C9SBY5
XP_003007790.1.67963 VDBG_01978T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]