SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_02200T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_02200T0
Domain Number 1 Region: 1920-2214
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-123
Family BEACH domain 0.0000000581
Further Details:      
 
Domain Number 2 Region: 1753-1884
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-24
Family PreBEACH PH-like domain 0.025
Further Details:      
 
Domain Number 3 Region: 2269-2523
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.37e-24
Family WD40-repeat 0.0078
Further Details:      
 
Domain Number 4 Region: 280-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000333
Family Clostridium neurotoxins, the second last domain 0.057
Further Details:      
 
Weak hits

Sequence:  VDBG_02200T0
Domain Number - Region: 788-839,889-968,1032-1048,1110-1150,1246-1466
Classification Level Classification E-value
Superfamily ARM repeat 0.000239
Family HspBP1 domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_02200T0
Sequence length 2531
Comment | VDBG_02200 | Verticillium albo-atrum VaMs.102 WD repeat and FYVE domain-containing protein (2532 aa)
Sequence
MSPPPTLQAHLKTISDTFEASTACWKSFEPFPLFWMFFLSRSGTPPGNKRYFRNRVERGG
WEALEQTTASIGLGGSDSDPWTQYQIFGKLLSFSLGNKRLDDLCQAVAQSIPDSSSHPAS
DTKSQTAAGNSEATAIEEPAFDIAHEVRNVIQKDSVFRNPEIIRTVVGFWESIPRGSDIP
AELTSLVVLDVLSTAVSVSVFNLAALHSTGVLSRFLRVYFTDNSMLSVPEKEKVLQLCKK
LMYLGVNQPADTQFLLASRSSEASDFALEMTSTYSGPPFFQFDLSLHGHSSIELPTLGRS
FPPNTSPGYTFTAWVRVDRFDPSSHTTLFGVCDATQTCFLLIYLERDTRNFILQTSVKTQ
RPSVRFKSVAFKERQWYHITLVHKRPKTITASKASLYINGEFVEQLKCAYPMPPPSSNGI
ADGFSAFTTATPKPKPVQAFLGTPKGLASRLGAGLVLSRWSLASAHLFEDVLSDDLIAVH
HALGARYQGNYQDSLGGFQTYEASANLGLRNEVFHPGKDESSDILRAIREKAGTLLPESK
TLLSILPTAVFREDGLHQDTQMHRSLPRAAAANLIQMTHRSGSAIAINAALPSLPDALAR
THGVAVLIGDPVVITPSHFDDNLWRLAGFTPLGLKIVERASTVEDIVRAVEMLFLCIKKS
WRNSEAMERDNGYAILGMLLRAKLGYSANLGAESVNLRLAISTAERDALSLQLLSRILEF
VGYNHEEPLESFIINPLAYRVLLIDFDTWRRSASLTQELYYKQFVTFSVMSKYHQFNGRR
LIRMRIVKRLLDAMKAEMISEDVISHLMKALEQLVKCNYTAEVHRALALFITYAFHSPAS
SASRTPKPLSIISRSSTPGGLVRRSTTDVNAPVGSVASSSPSSRYLTKKQLGTKVLGMYA
DLLCEKGNLTNIRKFARTVTNKVRMPDDPQSALLSMDQWLLYLLAEDDAETVVYGAKTLA
RLLVTHGTAYTSKFASKTGGLTIMANRLKRWWDLPTLWPICFSILFGYDVAEIDFTRDFE
FFSLLEIFGKSKVVYPEALPVIISMLQNGLKDVFRNQEDPNSPHAEESSSIAQTIRGTAV
ETRPRARSMELAQALESRNHTRKPSEQVMSHASTLNTVIQFLSDLHSRSSDFRDFALSSD
YVRQLLSALYPIVVSTDALTPETELGSRDSTLTFEGADVIIRPLAASGPSPIIRTSSIED
PTTPQTNLRGTPLRKASSFILLSTASQASDSASTKNKHARTTSSQHTSGATRDGLLELVI
NVFMDQVLNRKEFPGFGLFSKVPPGFQEHQAYFESYVLRHTIKHLSNSIQLKQDILSEPK
VLTNMARFSTHIGEAIFEGWFLNGAEVMMELGGMLLEYLQRPEISSLKSVRLCHQAVNTI
RDSFMKAILLRFSELDDPQTPEEDATRFMGRLFYWQTSILGCLSGDDEYTRLLWYQLYTK
LVDERESIRLAAANILRIMLVQKPEETTALFRQGLSSDERKLTADFKKLTEVDNETFVDW
VDQQRPSLDAFFFGGISKTWEDFVAIENQRTMESGRVRLLRRKERLKAWHNEALMADNIM
IRHQMANSSWMKSIFNSEHFKHQRLMQDQQDDMAFLASSLTKMDRELHRPGAVFSEHTHL
KWKLDRTEGRNRMRLRLLPDYSRDHEVFQPKRKAGDGAIGSAPKLNTAVAISPTPPSATP
TAPKASLARGLDSNDLEDDSEATFAKAEAATSGSVVAPEDDFELVDDPNDAFDGDDGFED
KNRKVMRRLEQGDQVLAVYNVSRIVGLEACEGILIIGKDAMYIVDNVFQCASGEIVNAWQ
APPDERDPFSEIITDAKTTEKRQNLGRSEQESRSWRWHDVISISKRRFLFRDVAIEVFFT
DGRSYLLTTMNSLSRDELFGKLMNKAPHTYAASSLPNPEDGWRLETLKVFEESPQGLSSK
FGNIFNTAPWNPSMKKWQKGEISNFHYLMLVNTMAGRTFNDLTQYPVFPWVLADYTSEEL
NLNDPATFRDLSKPMGAQTSGRVSGFKESYNALEEIGETPFHYGTHYSSAMIVSSYLIRL
PPFVQSYILLQGGSFDHADRLFQSIPQAWKSASCENKADVRELIPEFFCLPEFLTNINGY
NFGNRESTGTKVDNVVLPPWAKGDPKIFIAKHREALESPYVSQHLHSWIDLVFGLKQRGE
AAVDNLNVFHHLSYRGATDLDNISDPQERRIAAGVIHNFGQTPHQVFSRAHPQRDNGQSP
SRRLDTSVYALTRLPHPLLESHDKVATLIYANKLDRLLCASSFRLNVPPYDKWLEWGYAD
NSIRFFFSDNRKAAGMFENLHIGQISCVVFANSKTLITAGEDCVISVYAVQTAPGRPVDL
LPRSSLFGHKAPVTTIAVSKSFSTFVSSSADGQAFLWDMNRLEFIRKLPLARQVECAAIN
DVSGEIMLCSGPNVVLYTINGSLILDQNVCMEPDDFVHACAFYEGTASEWLENSLIFTGH
RRGRVNVWRKIIRNGKWTLELLRRLDHIDPRSESGQNYDAGISCVTPLPHCVYTGDDDGR
VFEWNLVQRDR
Download sequence
Identical sequences C9S9M8
XP_003008012.1.67963 VDBG_02200T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]