SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_02849T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_02849T0
Domain Number 1 Region: 92-338
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-35
Family SSRP1-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_02849T0
Sequence length 433
Comment | VDBG_02849 | Verticillium albo-atrum VaMs.102 histone chaperone Rttp106-like protein (434 aa)
Sequence
MAPGLDIQRLGVVFQSRPDILEGIQREANSASRVTLFNDIASFVYEQTNGPEPAAKRRRV
DVDASNGFKASNGNGTINVAGSVPASAAEAAVDEPVQLEIKEISVSVPQRKKFELCFTEN
HLYARVPGTTAPAAGIAYAWGDIEYAFYLPIPEKTQVQHNYIIFPRGSCLPSKTETTIPT
AEPLVFTVPATAPKQGTILGPKASSAAAVSDTYRSLFDWALTTHLRAASNPINIVSADPA
KFHSMVRQPHRPNEKAVHVKAFRGSKDGYLFFLPTGILWGFKKPLLFIPLERISSLSYTS
VLQRTFNIVVEAFTGEGDATEELEFAMLDQEDYQGIDESYAGKKAAGAGDVAPDASADTD
GRTELEKAQAEAELQLQDEEDEDEEDYDPGSEGESEGSGVSSDEDDEDDDQEMEDGEDDE
GDDAGDESTNVKG
Download sequence
Identical sequences C9SCC5
XP_003006710.1.67963 VDBG_02849T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]