SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_03132T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_03132T0
Domain Number 1 Region: 719-861,940-959
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-33
Family Sec7 domain 0.00046
Further Details:      
 
Domain Number 2 Region: 1125-1168,1198-1260
Classification Level Classification E-value
Superfamily PH domain-like 0.000000224
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_03132T0
Sequence length 1462
Comment | VDBG_03132 | Verticillium albo-atrum VaMs.102 Sec7 domain-containing protein (1463 aa)
Sequence
MSGDTSTQRRRRRPDLNIDTSPKHDSNTHAVSRDKSLCDADPLTPPGKSKTSAPLPKKPA
PRALKAPSYSTHNADDSFLETPTPIDTDMSNKENTNPAYSRARDSHDLSLPARQVTRDSL
MTNMLMSLDQFSMPSLGTNASGSGTISGNGKGALFDDASQGYVYNSDADPLARATAGRDR
RANGHGYSYSSDFDGADDSSRYSSQHSRGRRSNSSSNFQTNLGRINSIRSTPGTPRHMHS
RGGGKGSKSSSTNSVDAGYAQVLSSQRWAHGFGKRSSSFDYGHRPQITTNNSQQAPWHVE
FSNTFLSDDYDAAPTPTVPGGPRRFPVITSPTFPPVPPEPIEPQAPALERKRSARSAKST
ATSRKTDSKSNTMTRESIPQNTPTPEPDSAPAPHIGYEKTKVAVHGAPAPTQPPSQTKER
PGFFRRVFGSSKSNAASNNVEPAQASVTDTENRPGSRPQNGASQAKSQSTPPSRDTSSSQ
SHQPVLHKKPSSFFRRRKKSNAEPPVPPVPAPSIEPPMPSAVPPPFLIPPSKDKLAVKPE
PSPVSSLRRVMNPYLKGSPVTPNAPHPFQTTAQNAEASPEPEVRRNDTPTRPPPEVPQPI
GKRDDSFLNLDGSDDNEVEGSTKYKTASTERMRKASKELLSAPALAPPVVKENAHRARMP
KANETEVVDSEDENRSTLVLPLEGARSASIRSGSTGTEYKSALQTPSVTVEDSSKMLDSM
NGKPLDEPEFVVGDPTDDDRQKAQKIYDGNEDFIQKEKAAAWMGEEGLVRQRTLQAYMEL
YDFANKSVVQALRQVCERLVFRAETQQVDRILVAFSKRWCDCNPNHGFKASDLHLADIEF
KMTRSQFVKNTITTIIQAVGEAAPNAFKRPSILPEKDSLHATNEDVRPSADERSNRFSFK
PAPRREPSADGAEGVEKDECGPLVKAPFGGTMRAWEAQVEIVLKLIYASIRDERLPLFGA
EPSRNLGPTSYSNLSVMGMLKRSPSVLSKAPSESHSSIRGRLAENSRTNTARFGSKSRSR
PRLGHNGFSSSRTSFDDGNSIWSPTPSSATWSRYSLGRTQGSMSMDSFGTPFPRGDYQQS
IGFANALSQAIIRDDASGFGPAASIMSDEAHVPLLEDESLELAGPPWVKEGMVTHKHHLD
GVAKKAKDRNWTEVFAVVQKGQMSLFSFTANKSMGRKSKMARNAAKSSTVAVGGGNWQDN
ATNLGTFSLRQTLASALPSPGYSRTRPHVWALSLPTGAVHLFQVGTPEISKEFVTTANYW
SARLSTHPLIGGISNIEYGWSDAIINNALVTAIHESTGGAPPSGRTSRPGSSATANASNP
PAARTSMQSSRSFRSASFDYPSGSYGSGNRGPEAEQLLTLLAYVKGVEDELQVHNSLRSP
MLLAFTPRGHNAGRAMANWERKSSYLLREIVKFRTYVDCLQQADTRREEIYNERDTARRA
ALGDLSDEEVEVAADGDATLRA
Download sequence
Identical sequences C9SD58
XP_003006993.1.67963 VDBG_03132T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]