SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_06791T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_06791T0
Domain Number 1 Region: 457-659
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-57
Family Protein kinases, catalytic subunit 0.00000121
Further Details:      
 
Domain Number 2 Region: 83-207
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000028
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  VDBG_06791T0
Domain Number - Region: 199-266
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0732
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) VDBG_06791T0
Sequence length 778
Comment | VDBG_06791 | Verticillium albo-atrum VaMs.102 serine/threonine-protein kinase shk2 (779 aa)
Sequence
MANDRSVYSSGQFMNPGPAPRPPTDNRPRLALTPNANLPGSMANMAISPIRSTTTSTYTG
STISLPIARQNSSQTDGMGGVAIRKEGWAQVKESKNFINPWKQRLLVLRKESLDFHKTEG
GKVAYTLYLKDVVNVGRVEAAGTIFEIKRNPNGSSNSPGEDDGQTKTLQIRVKSDDDLYE
WIDLIYGACPGMGGVSNPTNFSHAVHVGFDPQTGEFVGLPPEWSKLLNSSAITKEDYERN
PQAVFEMEAHRQREIDEANRRDLEAYNAAIPKTKVPMAQQELGGYGGGGSSSPSPADRYN
PSRAAPPAPKASNQQVGSLRAQRPAPSPPTAGSTRPPLSSQQSSSSLRDPNQAQRAPPRP
DPNQQRYPNGSSASQPRQNGPSQAQAPSRLPAPVKPLNVNKAPAPQPSDGVKAAEAALSA
KPPASERKQDVRMSTMSEGEVMAKLKEAVSKDDPNLSYSKQKKIGQGASGSVYVAKVKET
AQSPIARELLRSQGLKAQVAIKQMDLAHQPRKELIVNEIMVMKDSRHRNIVNFLDAFLRN
NNSELEEQISTICLETCRGLQHLHSQNIIHRDIKSDNVLLDARGNVKITDFGFCAKLTES
KSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPAQGAVSHR
DERYAASQEAGEAEQGAQGLPVGGAEERERETRTRTRTRSAEKQRKGFSPTSRRRVIGRN
GKAPSPNTARGFMPNSDGTTDRTDDDRGRGGYGGGHGRGRGRGYGPGLWSVVCADECA
Download sequence
Identical sequences C9SPG6
VDBG_06791T0 XP_003003229.1.67963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]