SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for VDBG_07001T0 from Verticillium albo-atrum VaMs.102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  VDBG_07001T0
Domain Number 1 Region: 30-157
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-24
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 293-401
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-23
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) VDBG_07001T0
Sequence length 422
Comment | VDBG_07001 | Verticillium albo-atrum VaMs.102 PH domain-containing protein (423 aa)
Sequence
MAAVSQQLRPVLPERGTTIAIPTTAPPALISSDANQTRLRSQSMLDTYASPVNQNGSFEF
DREVKSGHVQKRTQKTKTWKSIYLVLRPNALSLYKTDKEDKLRHKINLSDLTAVALLRDP
KQKRKHVFGCFSPAKNYHFQAKDDNDAQQWVDLIRTYARIDEEEEELLLASPVAQRGSYL
PPISNGSYTDPALRERVTFSSPEPLDPPAPRFMSTDKRRPSNMLDSSGYSGNELASHSDF
SDTEMQRLRGMSIEDLAGQSPQDSGVLSDSGLPDRPQMKHRNSSQVSGLNLEHDPDRVIW
QGWLWFLRNKGGVRQWKRQWAVLRPRNFILYKDESEYTAQFLRPMSAVVDVVDIDPVSKT
KSHCLQLITDEKSYRFCAPDEESLVLCLGAFKSLLAKRRELEARAAANASHATAIPAPVS
TV
Download sequence
Identical sequences C9SR89
XP_003002430.1.67963 VDBG_07001T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]